KEGG   Actinoplanes sp. SE50/110: ACPL_7767Help
Entry
ACPL_7767         CDS       T02044                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACPL_7767 (deoA)
Enzymes [BR:ase01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ACPL_7767 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8579619..8580896)
Genome map
AA seq 425 aa AA seqDB search
MSGITAVDVIRAKRDGRALSDAQIDWVVDAYTRGVVADEQMSALAMAILLRGMTAAEIAR
WTAAMIASGERLDLSPVSRPTADKHSTGGVGDKITLPLTPLVAACGVAVPQLSGRGLGHT
GGTLDKLESIPGWRARLGNDEFIGQLRDIGAVICAAGEGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDLASAQELARTMVQLGKDSGVTTVALLT
DMSTPLGLAVGNANEVAESVEVLAGGGPSDVVELTLALAREMLSAAGVDADPEKMLASGA
AMDSWRAMIRAQGGDPDAPLPGPRHTEVLRAAADGVVTTMDAYGIGVAAWRLGAGRARKE
DPVSFGAGVQLKVKPGDRVKAGDVLLELRTDDEGRIPAARADAQAAIMIGTDAPASAGLL
LDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcactgcggtagacgtcatccgggccaagcgggacggccgggcgctgtcc
gacgcgcagatcgactgggtggtcgacgcgtacacccggggggtggtcgccgacgagcag
atgtccgcgctggccatggcgatcctgctgcgcggcatgacggccgccgagatcgcccgc
tggaccgccgcgatgatcgccagcggcgagcggctggacctgtccccggtgtcccggccg
accgccgacaagcactccaccggcggcgtcggcgacaagatcaccctgccgctgaccccg
ctggtcgccgcgtgcggggtggccgtgccgcagctgtccggccggggcctcgggcacacc
ggcggcactctggacaagctggagtcgatccccggctggcgggcccggctcggcaacgac
gagttcatcggccagctgcgcgacatcggcgcggtgatctgcgcggccggcgagggcctg
gccccggccgaccgcaagctgtacgcgctgcgcgacgtgaccggcacggtcgaggcgatc
ccgctgatcgccagctcgatcatgagcaagaagatcgccgagggcaccggcgcgctggtg
ctcgacgtcaaggtcggttccggcgcgttcatgaaggacctggccagcgcccaggagctg
gctcggaccatggtccagctgggcaaggacagcggggtcaccacggtcgcgctgctcacc
gacatgagcaccccgctcggcctggccgtcggcaacgccaacgaggtggccgagtcggtc
gaggtgctggccggcggtggcccctccgatgtggtggagctgaccctggccctggcccgg
gagatgctgtccgccgccggggtggacgccgacccggagaagatgctcgcctccggcgcc
gcgatggactcgtggcgggcgatgatccgcgcccagggcggcgacccggacgcgccgctg
cccggcccgcggcacaccgaggtgctccgcgcggccgccgacggcgtggtgaccacgatg
gacgcgtacgggatcggggtcgccgcctggcgtctcggcgccggccgcgcccgcaaggag
gacccggtcagcttcggcgccggggtgcagctcaaggtcaagcccggcgaccgggtcaag
gccggtgacgtgctgctggaactgcgcaccgacgacgaggggcggatcccggcggcccgc
gccgatgcacaggccgcgatcatgatcgggaccgatgcccccgcctctgccggtctgctg
ctggaccgcatagcctga

DBGET integrated database retrieval system