KEGG   Actinoplanes sp. SE50/110: ACPL_7784Help
Entry
ACPL_7784         CDS       T02044                                 

Definition
Inositol-1-monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACPL_7784
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ACPL_7784
Transfer RNA biogenesis [BR:ase03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ACPL_7784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8596250..8597092)
Genome map
AA seq 280 aa AA seqDB search
MGEQIGAEGGTPPVIDAAFARWLADRAGQELLRVRAEVGFHDGKALKTAGDKAAHDLLRA
ELARWRPADAVLSEEDEHARVAWREGEPDTVRPDRLDASRVWIVDPLDGTREFSEEGRGD
WAVHVALWNAGVLAAGAVAMPAQHRTIATDHPPAYPPMPLESATGGAIRIAASRTRPPAF
VTALAEELGAELVPMGSAGVKIAAVISGEADAYVHAGGQFEWDSAAPVAVALATGLHASR
VDGTPLSYNQADPKLPDLVVCRKDLAPRLLTAISRHLPSQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagcagatcggtgccgagggcggcacaccaccggtgatcgatgccgcgttcgcc
cgctggctcgccgaccgggccgggcaggagctgctgcgggtccgcgccgaggtgggcttc
cacgacggcaaggcgctcaagacggccggcgacaaggccgcgcacgacctgctgcgggcc
gagctggcccggtggcgcccggccgacgcggtgctgtcggaggaggacgagcacgcccgg
gtcgcgtggcgcgagggggagccggacacggtgcgccccgaccggctcgacgcgtcccgc
gtgtggatcgtcgacccgctcgacggcacccgcgagttctccgaggagggccgcggcgac
tgggcggtccatgtggccctctggaacgcgggcgtgctggccgccggcgcggtcgcgatg
ccggcccagcaccgcacgatcgccaccgaccacccgccggcgtacccgccgatgccgctg
gagtcggccaccggcggggcgatccggatcgcggccagccgcacccgcccgccggccttc
gtcaccgcgctcgccgaggagctgggcgccgagctggtgccgatgggctcggccggggtg
aagatcgccgcggtgatcagcggggaggcggacgcctatgtgcacgccggcgggcagttc
gagtgggactcggccgccccggtcgctgtggcgttggccacgggattgcacgcctcccgc
gtcgacggcaccccgctgagctacaaccaggccgatccgaagcttcctgacctggttgtt
tgtcgcaaagatctcgctcctcggttgcttactgcgatcagcaggcatcttccgtcacaa
tga

DBGET integrated database retrieval system