KEGG   Actinoplanes sp. SE50/110: ACPL_7811Help
Entry
ACPL_7811         CDS       T02044                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACPL_7811 (gtaB)
   00052 Galactose metabolism
    ACPL_7811 (gtaB)
   00500 Starch and sucrose metabolism
    ACPL_7811 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    ACPL_7811 (gtaB)
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACPL_7811 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8626854..8627765)
Genome map
AA seq 303 aa AA seqDB search
MTTNAQGSGKRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEAAAAGITD
VLLVTGRGKTSMVDHFDRRPDVEQRLEEKGDTERLAAVRRTSELADIYTCRQGEPLGLGH
AVGTAASHVGDNPFAVLLGDEFVEEGSPLLPDMLDLQARTGGIVLAFIEVTPEETSRYGI
ASVRESDLGEGVVEVTGLVEKPSPEEAPSNLAVVGRYVLPGRIFETIAGTKPGSGGEIQL
TDAMATLLAEGTPVHGIVYRGVRYDTGQPLGYLQTVVQLAAQRPDLGAEFRAWLTDFVGG
QKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaacgcgcaagggtcgggcaagcgcgcggtgaaagcagtgattccggcggcc
ggcctagccacgcgtttcctgcctgccaccaaagccgttccgaaagagctgctgccggtc
gtcgaccggccggtcctgcagtacatcgtcgaggaggccgccgcggccggcatcaccgac
gtgctgctggtgaccgggcgtggcaagacctcgatggtcgaccacttcgaccgtcgcccc
gacgtggagcagcggctggaggagaagggcgacaccgagcggctcgccgccgtccggcgc
accagtgagctggccgacatctacacctgccgacagggggagccgctcggcctcggccat
gccgtcgggaccgccgcctcgcacgtcggggacaacccgttcgcggtgctgctcggggac
gagttcgtcgaggagggcagcccgctgctgcccgacatgctcgacctgcaggcccgcacc
ggcggcatcgtgctcgccttcatcgaggtcaccccggaggagacgtcgcgctacgggatc
gcctcggtgcgggagtccgacctgggcgagggcgtggtcgaggtgaccggcctggtggag
aagccgtcgccggaggaggcgccgagcaaccttgccgtggtggggcggtacgtgctgcct
ggcaggatcttcgagacgatcgccggcaccaagccgggcagcgggggcgagatccagctg
accgacgcgatggcgacgctgctggccgagggcaccccggtgcacggcatcgtctaccgc
ggtgtccggtacgacaccggccagccgctgggctacctgcagaccgtcgtccagctcgcg
gctcagcgtcccgacctgggtgccgagttccgggcctggctcaccgacttcgtcggtggt
cagaagggatga

DBGET integrated database retrieval system