KEGG   Actinoplanes sp. SE50/110: ACPL_7881Help
Entry
ACPL_7881         CDS       T02044                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_7881 (gpmA)
   01230 Biosynthesis of amino acids
    ACPL_7881 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_7881 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ACPL_7881 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_7881 (gpmA)
Enzymes [BR:ase01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ACPL_7881 (gpmA)
Exosome [BR:ase04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ACPL_7881 (gpmA)
  Exosomal proteins of melanoma cells
   ACPL_7881 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8693528..8694274)
Genome map
AA seq 248 aa AA seqDB search
MTGTLVLLRHGNSEWNAKNLFTGWVDVDLDAKGEDEARRGGELLKEQNVLPDVVHTSLLR
RAIRTSEIALHITDRHWIPVKRSWRLNERHYGALQGKDKKQTLDTYGEEQFMLWRRSYDV
PPPPIEDDSEFSQANDARYADLPPEIKPKAECLKDVLDRALPYWYDAIVPDLRAGKTVLV
AAHGNSLRAIVKHLDAISDEAIAKLNIPTGIPLRYDLDENLRPITAGGTYLDPQAAKEAA
AAVANQGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccctggtgctgttgcggcacggcaacagcgagtggaacgccaagaacctc
ttcaccggctgggtcgacgtggacctggacgccaagggcgaggatgaggcccggcgcggc
ggagagctgctcaaggaacagaatgtgctgcccgacgtcgtgcacaccagcctgctgcgg
cgtgccatccgcaccagcgagatcgccctgcacatcaccgaccggcactggatcccggtg
aagcggtcgtggcggctcaacgagcggcactacggcgctctgcagggcaaggacaagaag
cagaccctggacacctacggcgaggagcagttcatgctctggcgccggtcgtacgacgtg
cccccgccgccgatcgaggacgactcggagttctcccaggcgaacgacgcccgttacgcc
gacctcccgccggagatcaagccgaaggcggagtgcctgaaggacgtgctcgaccgcgcc
ctgccgtactggtacgacgcgatcgtcccggacctgcgggccggtaagacggtgctggtc
gccgcgcacggcaactcgctgcgcgcgatcgtcaagcacctggacgcgatctccgacgag
gcgatcgcgaagctgaacatcccgaccggcatcccgctgcgctacgacctggacgagaac
ctgcgcccgatcacggccggcgggacgtacctggacccgcaggcggccaaggaggccgcg
gccgcggtcgccaaccaggggcgctga

DBGET integrated database retrieval system