KEGG   Actinoplanes sp. SE50/110: ACPL_7933Help
Entry
ACPL_7933         CDS       T02044                                 

Definition
two-component system, chemotaxis family, response regulator CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ase00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACPL_7933
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ACPL_7933
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ACPL_7933
Two-component system [BR:ase02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ACPL_7933
Bacterial motility proteins [BR:ase02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ACPL_7933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8740391..8741572)
Genome map
AA seq 393 aa AA seqDB search
MISVLVVDDSVVVRRLIVDALGEAPGIQVVGTAANGLLAQAKIDQLKPDVVTMDIEMPQM
DGIEAVRELRKRHAALPVIMFSTLSAAGATATLEALSAGATDYVTKPSNVGSVKESIEAV
REQLVPKIQALGGRRRPPPGAPPRGPAPAAGPRPGIGPVPGRPGLTPPGPARPPAPAAPA
GPAGARPPARRGPQGRIDILAIGSSTGGPDALTKVLHGLPADLPVPVVITQHMPPVFTKM
FAERLDRSIPLKVVEAGDGMELAPGTVYIAPGDRHLIFNRRGTSTLTQLSNAPQENSCRP
AVDVMFRSVAALYGGTAFATVLTGMGQDGRGGAKVLRDAGCEILAQDEASSVVWGMPGAV
VGAGLADEVLPLDRIAAALLNRVRVGRSAAVAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatctcggttctcgtcgtcgacgattccgtggtggtccgtcggctgatcgtcgacgct
ctcggggaggcgccgggcattcaggtggtcggcaccgcggcgaacggcctactggcacag
gccaagatcgaccagctcaaacccgacgtggtcaccatggacatcgagatgccgcagatg
gacggcatcgaggcggtgcgtgaactccgcaaacggcacgccgcgctgccggtgatcatg
ttcagcacgctgtccgcggcgggcgccaccgccaccctggaggcgctctccgcgggtgcc
accgactacgtgaccaagcccagcaacgtgggctcggtgaaggaatcgatcgaggcggta
cgcgaacagctcgtacccaagatccaggcgctcggtgggcgccgtcgcccgccgcccggc
gcgccgccgcgaggccccgccccggcggccggcccgcgccccggcatcggaccggtgccc
ggccgtccgggtctgaccccacccggcccggcccgcccgcccgctcccgccgctcccgcc
ggcccggccggggcccgcccgccggcccgccgtggcccgcagggccggatcgacatcctg
gcgatcggctcgtccaccggcggcccggacgcgctgaccaaggtgctgcacgggttgccg
gccgacctcccggtcccggtggtgatcacccagcacatgccgccggtcttcaccaagatg
ttcgccgaacggctggaccgcagcatcccgttgaaggtggtcgaggccggcgacggcatg
gaactggcgcccggcacggtctacatcgcgccgggcgaccggcacctgatcttcaaccgc
cggggcacgtcgacgctgacccagctcagcaacgcaccacaggagaactcctgccggccc
gccgtggacgtgatgttccggtcggtggccgcgctgtacggcggcaccgcgttcgccacg
gtgcttactggaatgggacaagacggacgaggtggtgcgaaggtgctgcgagacgcgggc
tgtgagattctggcccaggacgaggcgtcctcggtggtgtggggcatgccgggcgccgtg
gtcggcgcgggtctggccgatgaggtgttgcctctcgaccggatcgcggcggcgctgctg
aaccgggtgcgggtgggacggtccgcggcggtggcccgatga

DBGET integrated database retrieval system