KEGG   Actinoplanes sp. SE50/110: ACPL_7998Help
Entry
ACPL_7998         CDS       T02044                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00010  Glycolysis / Gluconeogenesis
ase00052  Galactose metabolism
ase00500  Starch and sucrose metabolism
ase00520  Amino sugar and nucleotide sugar metabolism
ase00521  Streptomycin biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
Module
ase_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_7998
   00052 Galactose metabolism
    ACPL_7998
   00500 Starch and sucrose metabolism
    ACPL_7998
   00520 Amino sugar and nucleotide sugar metabolism
    ACPL_7998
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACPL_7998
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ACPL_7998
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ACPL_7998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEV88876
UniProt: G8S9A0
Position
8805197..8806138
Genome map
AA seq 313 aa AA seqDB search
MTRFAVPDSVVIALDVGGTGMKCALVRPGGVVHHEERHPTLAGRGPQAVTEDILGVAEGL
AGKARADGLTPIAAGIAVPGVVDETTGVAVWSANIGFRDVPLKDLAERRLGLPAALGHDV
RVGALAEARLGAGRGRRHVLFVAIGTGIAGGLVVNGTGYSGAHGAAGEIGHVTVRPGGVP
CGCGLRGCLEAEASARAVGRRYAELSGQAGATAFDVATRAAAGEELAGRVWQDAVEALAD
GLLAAQALYDVSVVVLGGGLAEARDDLLVPVREAFARRVTFHRTPEIVRAELGDTAGCLG
AALLALDSLGTPQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcttcgccgtgccggacagtgtcgtcatcgccctcgacgtcgggggcaccggg
atgaagtgcgcgctggtccgcccgggcggggtggtgcaccacgaggaacggcacccgacc
ctggccggccgggggccgcaagcggtcaccgaggacatcctgggcgtcgccgaggggctg
gccggcaaggcccgcgccgatgggctcaccccgatcgcggccggcatcgcggtgcccggg
gtggtcgacgagaccaccggggtcgcggtctggtcggcgaacatcgggttccgtgacgta
ccgctgaaagatcttgccgagcggcgcctcgggctgcccgcggccctcggtcacgacgtg
cgtgtcggtgccctcgccgaggcccgcctgggcgccgggcgcggacgccggcacgtgctg
ttcgtcgcgatcggcaccggcatcgccggcggcctggtggtgaacggcaccggctactcc
ggcgcgcacggggcggccggcgagatcgggcacgtgacggtccgccccggcggcgtcccg
tgcggctgcggcctgcgcggctgcctggaggcggaggcgtcggcccgggccgtcggccgc
cgctacgccgaactgtccgggcaggccggggccaccgccttcgacgtggccacccgggcc
gcggccggcgaggaactggccggccgggtgtggcaggacgccgtcgaggcgctcgccgac
gggctgctcgcggcgcaggcgctctacgacgtgagcgtggtggtgctcggcggcggcctg
gccgaggcgcgcgacgacctgctggtgccggtccgcgaagcgttcgcccggcgggtcacc
ttccaccgcacccccgagatcgtccgggccgagctcggcgacaccgccggctgcctgggc
gccgccctgctcgccctcgactccctggggaccccgcaatga

DBGET integrated database retrieval system