KEGG   Actinoplanes sp. SE50/110: ACPL_8079Help
Entry
ACPL_8079         CDS       T02044                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACPL_8079 (folP)
Enzymes [BR:ase01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ACPL_8079 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8894022..8894834)
Genome map
AA seq 270 aa AA seqDB search
MGVLNVTPDSFSDGGRYTDLDAAVEHGISLYAQGADIIDVGGESTRPGAERVDAATEAAR
VVPVIAALTAAGVPLSIDTTRAAVAEAALAAGAAVINDVSGGLADPGMAAVAAAAGCPWI
LMHWRGHSRDMQRLATYQDVVTEVRDELRARADAAVTAGVDPARIVLDPGLGFAKNAEHN
WALSARLDVLVALGFPVLFAASRKTYLGRLLAGPDGTPRPVDGREAATLATSLLAVAAGA
WGVRVHEVRETADALAVWRATGAPRLALEK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcctgaacgtcacgccggactccttctccgacggcgggcgctacaccgacctg
gacgccgccgtcgaacatggcatttctttgtacgcgcagggggcggacatcatcgatgtg
ggcggtgagtccacccgcccgggcgccgagcgggtcgacgccgcgaccgaggccgcccgg
gtggtcccggtgatcgccgcgctgaccgctgccggggtgccgctgagcatcgacaccacc
cgcgccgccgtcgccgaggcggcgctggcggccggtgccgcggtgatcaacgacgtctcc
ggcgggctggccgacccgggcatggccgcggtcgccgcggcggccggctgcccgtggatc
ctgatgcactggcgcgggcactcccgcgacatgcaacgcctggccacctatcaggacgtg
gtcaccgaggtgcgcgacgagctgcgggcccgcgccgacgcggcggtcacggccggggtg
gacccggcgcggatcgtcctcgacccggggctgggcttcgccaagaacgccgagcacaac
tgggcgctcagcgcgcggctcgacgtactggtcgccctgggcttcccggtgctcttcgcg
gccagccgcaagacctacctgggccggttgctggccggcccggacgggacgccgcggccg
gtggacgggcgggaggcggccaccctggccacctcgctgctggcggtcgcggccggcgcc
tggggcgtccgggtgcacgaggtccgggagaccgccgacgcgctcgccgtctggcgcgcc
accggagcgcctcggctggccctggagaagtag

DBGET integrated database retrieval system