KEGG   Actinoplanes sp. SE50/110: ACPL_8240Help
Entry
ACPL_8240         CDS       T02044                                 

Definition
ubiquinone/menaquinone biosynthesis methyltransferase ubiE (EC:2.1.1.-)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ase  Actinoplanes sp. SE50/110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9077764..9078855
Genome map
AA seq 363 aa AA seqDB search
MTDLNEAFGAVPVLAYTDHERYGPTVHRSVPEWIQREVTSLRVQAGHRVLEIGTGSGYSG
ALLARLCGPRGRVTSIDISEELINRARAIHAERGVTEIDCHVADGLAGFPTAAPFDRAVG
WCTPPRLPRTWVEQITDGGRIVASLPIAPLPSTALITTITVDAGQPRVQAVVGGVYAQST
PAPVDDAVTVPGRWVDYCDRQPDPSWIAISWRTEDPHNSGARAALDRLLNPGHTETYGDM
EADWRSWSAHTAAPPDPGLSMVSLRNQIRGIGHTTATSAAVILTDGTIIADTPDSASLTV
LREWLILWQQAGRPTADSFIPRLVPNTSIDCPGGDLQLAVPADAVPASRAAIPQPRAGRV
EPA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctcaatgaggctttcggtgccgtgcccgttctcgcctataccgatcacgag
cgctacggtccgaccgtccaccgctccgtgcctgagtggattcagcgtgaagtgacatcc
ctacgggtgcaggccgggcatcgcgttctggaaatcggcaccggctccggttacagcggc
gccctgctcgcccgcctgtgcggaccacgcgggcgagtcacgagcatcgacatcagcgag
gaactcatcaaccgggcgcgcgcgatccacgccgaacgcggagtcaccgagatcgactgt
cacgtcgccgacggcctggccggcttccccaccgccgcgccgttcgatcgggcggtcggg
tggtgcactccgccgcggcttccccggacctgggtcgagcagatcacggatggcggccgg
atcgtcgcctccctgccaatcgcaccgctaccgtccaccgccttgatcaccaccatcact
gtcgacgccgggcagccccgagtgcaggccgtcgtcggtggggtttacgcccagagcacc
ccggcgcccgtggacgacgccgtgaccgtgcccggccggtgggtcgactactgcgaccgc
caaccggatccgtcctggatagccatcagctggcgcaccgaagatccacacaacagcggc
gcccgcgcggccctcgaccggctcctcaaccccgggcacaccgaaacctacggcgacatg
gaggccgactggcggtcctggagcgcccacaccgccgccccgcccgaccccggtctgagc
atggtgtcgctgcgcaatcagatccgcgggatcggccacaccaccgccacatccgcagcc
gtgatcctgaccgacggcacgatcatcgccgacacaccggactcggcgtcgctaacggtc
ctacgcgagtggctaatcctctggcagcaggccggccgccccaccgccgacagcttcatt
ccccgactggtccccaacacgagcatcgactgccccggcggggacctacagctagccgtg
cccgctgacgcggtgccagcgtcgcgggccgctatcccgcagccgcgcgccggccgggtg
gagccggcatga

DBGET integrated database retrieval system