KEGG   Actinoplanes sp. SE50/110: ACPL_8276Help
Entry
ACPL_8276         CDS       T02044                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ase03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9117396..9118193
Genome map
AA seq 265 aa AA seqDB search
MQRLEVASFSALKTYDPAPSALTGLPITSAGRHGKFLDIGIGLDVHLVVHLARAGWLHYR
DTFKSPAPLKPGSGPIAIRLRLDDGSGFDLTEAGTQKSLAAYLVRDPQTEVPGVSRLGPD
ALAVTRDEFARLIRSRNGQVKGVLTDQEVLAGIGNAYSDEILHVAKMSPFALTGKLTEEQ
LTTLYEAMREVETDAVQRSVGQKAAELKGEKRAGMRVHARTGLPCPVCGDTVREVSFADK
SLQYCATCQTGGKPLADRRLSKLVR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgcctcgaggtcgcctcgttcagcgcgctgaagacgtacgatccggcgccctcc
gccctgaccggcctgccgatcacctcggccggccggcacggcaagttcctggacatcggc
atcggcctggacgtgcacctggtcgtgcacctggcccgggccggctggctgcactaccgc
gacacgttcaagtcgccggccccgctcaaaccgggcagcgggccgatcgcgatccggctg
cggctcgacgacggctccggcttcgacctgaccgaggccggcacccagaagtcgctcgcg
gcctacctggtccgcgacccgcagaccgaggttccgggggtgtcccggctcggcccggac
gcgctcgcggtcacccgcgacgagttcgcccggctgatccggtcacgcaacggccaggtc
aagggcgtgctcaccgatcaggaggtgctcgccgggatcggtaatgcgtactccgacgag
atcctgcatgtggcgaagatgtcaccgttcgcgttgaccgggaagctcaccgaggagcag
ctcaccacgttgtacgaagcgatgcgcgaagtggagaccgacgccgtgcaacgatccgtc
ggacagaaggcggccgagctcaagggcgagaaacgggccggcatgcgggtgcacgcccgg
accggcctgccgtgcccggtttgcggcgacaccgtgcgcgaggtctcgttcgccgacaag
agcctgcagtactgcgcgacgtgccagaccggcggcaaaccgctcgccgaccgccgcctg
tccaagttggtgcggtga

DBGET integrated database retrieval system