KEGG   Actinoplanes sp. SE50/110: ACPL_832Help
Entry
ACPL_832          CDS       T02044                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ase00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(813259..814383)
Genome map
AA seq 374 aa AA seqDB search
MTERIPAARRSALDEPAAVLAGYTVGVTSDRRRDELAALLEGRGARVVLAPALRIVPIAD
DAELRAATRACLDSPPDIVLVSTGIGMRGWLEAAESWGLAEPLRAVLDRSYLVARGPKAR
AAVRTAGLRECWTPEGESSAEVVEHLTTRGLGGLTVALQLHGESQPEYTEVLRAAGARVI
ELPVYRWAPPTDTAPLHRLVDLIAGRLVDAVTFTSAAAVHALLRAAGPAVDPLLDALRSD
VLAACVGPVTAEPLRRLEIPVTTPARARLSALVRTLTDELPQRAVSLQVNGHAITLRGHA
AVIDGRLRQLAPAPMAVLRALATSPGRVLSRAALLQTLPRHADEHAVEMAVARLRAAIPG
IVQTVVKRGYRIAG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcggatcccggcggcacgacggtcggcgctggacgagcccgcggccgtcctg
gccggatacaccgtcggcgtcacctccgaccggcgccgggatgagctggccgccctgctg
gagggccgcggcgcccgggtcgtgctcgcccccgcgctgcggatcgtgccgatcgccgac
gacgccgaactgcgcgccgccacccgtgcctgcctggactcacccccggacatcgtgctg
gtcagcaccgggatcgggatgcgcggctggctggaggccgcggagagctgggggctggcc
gagccactgcgcgcggtgctcgaccgctcctatctggtcgcccgcggccccaaggcgcgc
gccgcggtccgtaccgccggcctgcgggaatgctggaccccggagggcgagagctccgcg
gaggtggtcgagcacctgaccacccgcggcctcggcgggctgaccgtcgccctgcagttg
cacggggagagccagcccgaatacaccgaggtactgcgcgcggccggcgcccgggtgatc
gagttgccggtctaccgctgggcgccaccgaccgacaccgcgccgctgcaccgcctcgtc
gacctgatcgccggccggctggtcgacgccgtgacgttcacctcggcggccgccgtgcac
gcactgctgcgcgccgccggtccggccgtcgatccgctgctggacgcactccgctcggac
gtgctggccgcctgcgtcgggccggtcaccgccgagccgctgcgccggctggagatcccg
gtcacgacgccggcccgggcccggctcagcgcgctggttcgcaccctgaccgacgaactc
ccccagcgcgcggtctccctgcaggtcaacggccacgcgatcacgctgcgcgggcacgcc
gcggtgatcgacggccggctgcgccagctggccccggccccgatggcggtcctgcgcgcc
ctggccacctcaccgggccgggtcctgtcccgcgccgctctcctgcaaaccctcccccgc
cacgccgacgaacacgcggtcgagatggccgtcgcccgcctccgggccgccatccccggc
atcgtccagacggtcgtcaagcgcggctaccgcatcgccggctag

DBGET integrated database retrieval system