KEGG   Actinoplanes sp. SE50/110: ACPL_893Help
Entry
ACPL_893          CDS       T02044                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00020  Citrate cycle (TCA cycle)
ase00640  Propanoate metabolism
ase00660  C5-Branched dibasic acid metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
Module
ase_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ase_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACPL_893 (sucC)
   00640 Propanoate metabolism
    ACPL_893 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ACPL_893 (sucC)
Enzymes [BR:ase01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ACPL_893 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEV81790
UniProt: G8SIJ2
Position
881667..882845
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQGRDLFERHGLPVLGGGVAETPQEARAIAERLGGKVVVKAQVKVGGRGKAGGVK
LADGADEAEARATDILGMDIKGHTVHKVMLAETADIKEEYYFSYLLDRANRTFLCIASVA
GGMEIETVAEEDPERVAKVAIDASKGVDEAKAREIVTAAKFPADVADQVVDIAVKLWQAF
VAEDALLVEVNPLAKVGDGRVLALDAKVTLDENAGFRHPDHEALEDKSAVDPIEQAAKAK
NLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGNVKPANFLDIGGGASAQVMANGLE
IVLGDPAVKSVFVNVFGGITACDAVANGIIQALALLAERGETVTKPLVVRLDGNNAEAGR
AILDGANNPLVERVDTMDGAAARAAELAAAGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtatcaggggcgcgacctgttcgaacggcacgggctgcccgtgctg
ggcggcggtgtcgccgagaccccgcaggaggcccgggcgatcgccgagcgactcggtggc
aaggtcgtcgtcaaggcgcaggtcaaggtcggcggccggggcaaggccggcggcgtcaag
ctggctgacggtgcggacgaggcggaggcccgtgcgaccgacatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggccgagacggccgacatcaaggaggagtac
tacttctcctacctgctggaccgggcgaaccgcaccttcctctgcatcgccagcgtcgcc
ggcggcatggagatcgagacggtcgccgaggaggacccggagcgggtcgccaaggtcgcg
atcgacgcgagcaagggtgtcgacgaggcgaaggcgcgcgagatcgtcaccgccgccaag
ttcccggccgacgtcgccgaccaggtggtcgacatcgcggtgaagctgtggcaggcgttc
gtcgccgaggacgcgctgctggtcgaggtcaacccgctggccaaggtcggcgacggccgg
gtgctggcgctggacgccaaggtcaccctggacgagaacgccggcttccggcaccccgac
cacgaggcgctcgaggacaagtccgcggtcgacccgatcgagcaggcggccaaggcgaag
aacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggtgcgggcctg
gtcatgtcgaccctcgacgtggtcgcctacgccggggagaagcacggcaacgtcaagccg
gcgaacttcctcgacatcggcggcggcgccagcgcccaggtgatggcgaacggcctggag
atcgttctcggcgacccggcggtcaagtcggtcttcgtgaacgtcttcggcggtatcacc
gcctgtgacgcggtggccaacggcatcatccaggctctcgccctgctggccgagcgcggc
gagacggtgaccaagccgctcgtcgtacgcctcgacggcaacaacgccgaggccggccgc
gccatcctcgacggcgccaacaacccgctggtcgagcgggtcgacacgatggacggagcg
gccgcgcgcgccgccgagctcgcggctgcggggaagtga

DBGET integrated database retrieval system