KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0034Help
Entry
SFBM_0034         CDS       T01591                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SFBM_0034 (recR)
DNA repair and recombination proteins [BR:asf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SFBM_0034 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
42397..42993
Genome map
AA seq 198 aa AA seqDB search
MIEYPEYIQKVVSEFSKLPGIGYKTAIRLTMHILNREINEINEFCDSVKKCKEKLRYCEK
CNNFSDDDICLICKDTSRDKSTICVVQDVKDVYAFEKIGSYKGLYYVLHGLISPIKGIGP
DDLKIELFVKRVKEEKINEVILATNPTLEGEATSIYISKLFSNEQKLTRLAYGVPLGSDL
EYVDEITLSRALDFRQRI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatagagtatccagagtatatacaaaaagttgttagtgagttttctaaattacctgga
ataggatataagacagctataagattaaccatgcatattttgaatagagaaataaatgag
atcaatgaattttgtgattctgtaaaaaaatgtaaagaaaaattaagatattgtgaaaaa
tgcaataatttttctgatgatgatatttgtttgatttgtaaggatacgagtagagataaa
tctacaatttgtgttgtacaagatgtaaaagatgtttatgcatttgagaagataggaagt
tataaagggttatactatgtgttgcacggattaatatctcctattaaaggtatcggtccg
gatgatcttaagatagaattgtttgttaagagagtaaaagaagaaaagataaatgaagtt
atattagcgacaaacccaactctcgagggagaggcaactagtatatatatatcaaaattg
ttttcaaatgaacagaaattaactagattagcatatggagtgcctttaggaagcgattta
gaatatgttgatgaaattactttaagtagagctttagattttagacaaagaatttag

DBGET integrated database retrieval system