KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0083Help
Entry
SFBM_0083         CDS       T01591                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFBM_0083 (pfkA)
   01230 Biosynthesis of amino acids
    SFBM_0083 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_0083 (pfkA)
   00030 Pentose phosphate pathway
    SFBM_0083 (pfkA)
   00051 Fructose and mannose metabolism
    SFBM_0083 (pfkA)
   00052 Galactose metabolism
    SFBM_0083 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SFBM_0083 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SFBM_0083 (pfkA)
Enzymes [BR:asf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SFBM_0083 (pfkA)
Protein phosphatases and associated proteins [BR:asf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SFBM_0083 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107242..108201
Genome map
AA seq 319 aa AA seqDB search
MKKIAILTSGGDAPGMNAAVRSVVRYALSKDIEVLGIHRGYHGLLHGEIESLSRRSVSDI
IDRGGTFLKTARCLEFKQEEVRAQAYEILKSHNVDGLVVVGGDGSFTGAHLLSKFGLSTV
GIPGTIDNDLPYTDYTIGFDTALNTILDAVRKLRDTSSSHERVSIVEVMGRNCGDLALYS
ALAGGAEAVIVPEYPFNREGLCKTILESKKNKKLHSLIILAEGAGNAEDLRKYIQQKIGL
DTRATVLGHIQRGGIPTGRDRVLASVMGRKAVDTLLSNEVCAKVIGVKENTVFDMDIEEA
LKIEKKFNKDLYDLVNKLV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcgattttaacaagtggtggagatgctccaggaatgaatgcagctgtt
aggtcggttgtgagatatgctttaagtaaagatatagaggttcttggaatacatagagga
taccatggacttttacacggtgaaatagaatctttaagtagaagatccgtttctgatatt
atagatagagggggaacattcttaaaaactgcaagatgtctcgagtttaaacaagaagaa
gtgagagctcaggcctatgagatattaaaaagtcataatgttgatggacttgtggttgta
ggtggtgatggatcatttactggggctcatttgttatcaaagtttggtttatctacagtt
ggtatacctggaactatagataatgatcttccttacacagactatacgattggatttgat
acagctcttaatacaatattggatgctgtgagaaaattgagagatacatcaagttctcat
gagagagttagtattgttgaagttatgggaagaaattgcggagatttagcattatattca
gctcttgctggtggcgctgaagcggtgattgttcctgagtatccttttaatcgtgaggga
ttatgtaaaactatattagagtctaagaaaaataaaaagcttcatagcctaataatttta
gcagaaggggcagggaatgcagaggatcttagaaagtatatacaacagaaaataggactt
gatactagggcgacagttcttggacatatacaacgtggagggataccgactggacgcgat
agagttttagcatctgtaatgggaagaaaagctgtagatactcttttgagcaatgaagtt
tgtgcaaaagttataggtgttaaagaaaatacagtgtttgatatggatatagaggaagct
ctaaagattgagaagaaatttaataaagatttatatgatcttgttaataaattggtataa

DBGET integrated database retrieval system