KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0186Help
Entry
SFBM_0186         CDS       T01591                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:asf00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:asf00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198789..202352
Genome map
AA seq 1187 aa AA seqDB search
MEIFSLDYAPEDRNLDFYRRDYDVSSWEYINVPSNWQMEGYDFPIYVNFRYPWTGFENLE
FYKAPKIFNPVGNYRRDFYVDESWLDDKVYISFQGVESCFYLWINGGFVGYSEDSFSPSE
FDVTDFLVCGNNSISVQVFRWCDGSFIEDQDFIRLSGIFRDVFLYRTPKIHIADFEVITK
ADDNYMNFDLLVNINMLNHINENRNYTISAVIFDEKWNLINSVENMGNFDRNYPYRDAIK
SDFSLCLNIKEPNRWSAEEPNLYNLIISLKNDLLNETQSIHTRVGFRAFEIKGNKMYING
KPILFKGVNRHETHPLKGRALSTLDMEFDIREIKKNNINSVRTSHYPNHPYFISLCNEYG
IYVVDEGNIEAHGVEGEIPGNKEIWKNACFDRINSLVERDKNNPSVLIWSLGNESGGGSV
FRDLYNYVSLRDGTRVIHYEGERDEYYASDVVSKMYVKIDDIEKQSKYMYHKPYILCEYA
HSMGNSGGSLDKYIEKFESIDNVQGGFIWDFIDQGIYRDVPDMGIFINSHSIFHGDFEGY
IENGYKDKGYRGCIFYDNVSNLKFDEFTIDLKVKPSVYEGEGCVYLKKGNEFGLREIMNY
DKSNNRAVEFYVRDNSGIFETIVFITPKDWVNNFHSVSAIYKNKIMRLFIDDNLVGEKTF
NYNIAYFKDGIQIGGNDGYTHCESMNGIIDEVKLFSKGMDIEELRKKSFYNIDATRIIWN
DFDNERNMIMKKLSRDKYLATGGDFNDSPNDSAFCANGILLASRKIKPQVSEVKYAYQNI
DIRDYDILNGKVIIKNKNLFKNLRDYILKWDYLVDGKIVRGDTAIVNVDPMSEIIFNVHD
MDKIKDLNGKEFFLNIGFVLNESTNWGNRGFEISRNQLKINLDNLFYEVGNVSKVVQNFM
IDDLSDKLEIKSKEYYIGFNKISGTLQNYRYKNEDLINSELYVDFWNPLNDNERLCNIYN
KIVFWKNIFNRSRNNSYNILHEDGCILVKFYKPIYDLNNSVLITTYKIDEYGEISIELYM
ELLKNGIPHARSVGFKIFIPTNFKNIEYYGRGPLENYNDRNKGSNLGEYKSDVDSQFTDY
MTPQRTGNITDIRWINFYRNNGIGIRIKYINEFLQINVSSYNDDEFEKKHSYQMNKYSSI
IVNVRSKDYGSTFESFEDECINYIDKNHIYNFSFKLSPLLTDNVLIN
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atggagattttttcacttgattatgcaccagaagatagaaatttagatttttataggaga
gattatgatgtatctagttgggaatatataaatgtgccgagtaattggcaaatggaggga
tatgatttccccatatatgttaattttagatatccttggactggatttgaaaatttagaa
ttttataaggctcctaagatttttaatcctgttggtaattataggagagatttttatgta
gatgaatcttggcttgatgataaagtttacatatcatttcagggtgttgaatcttgtttt
tatttatggataaatggaggatttgttggatatagtgaggatagtttttcacctagcgag
tttgatgttaccgattttttagtatgtggtaataattctatatctgttcaggtttttaga
tggtgtgatggaagttttattgaagatcaggattttattcggttaagtggaatttttagg
gatgtatttttatatagaacccctaagatacatattgcagattttgaggttataactaaa
gcggatgataactatatgaattttgatttgttagttaatattaatatgctcaatcacatt
aatgagaataggaattataccatatcggccgttatatttgacgagaaatggaatttaata
aatagtgttgagaatatgggtaattttgacaggaattatccatatagagatgctatcaag
agtgattttagtttatgtttgaatataaaagagcctaatagatggtcggcagaggaacct
aatttatataatttaataatttctcttaaaaatgatttgcttaatgaaacacaatcaata
catacaagggttggatttagagcatttgagataaaaggaaataaaatgtacataaatggg
aaaccgattttgtttaagggtgtaaatagacatgaaactcatccattaaaaggaagggca
ttatctacactggatatggaattcgatataagagagattaagaaaaataatataaactct
gtaagaacttcacattatcctaatcatccttattttatttcattatgtaatgaatatgga
atttatgtagttgatgagggtaatatagaggcacatggcgttgagggtgagatacctggg
aataaagagatttggaagaatgcatgttttgatagaattaattcacttgtagagagagat
aagaataatcctagtgttttaatatggtctcttggaaatgagagtggaggaggaagtgta
tttagagatttatataattatgttagtttaagagatggaaccagagtaatacactatgaa
ggcgagagagatgaatactatgcaagtgatgttgtaagtaaaatgtatgttaaaatagat
gacattgagaaacagagtaaatatatgtatcacaagccttatattttgtgtgaatatgct
cattctatgggaaatagtggtggaagtttagataaatatattgaaaaatttgagagtatt
gataatgttcagggaggatttatatgggattttatagatcaaggaatttatagagatgtt
cctgatatgggtatttttattaattctcatagtatatttcatggagattttgaaggatat
atagaaaatggatacaaagataaagggtataggggatgtatattctatgataatgttagt
aatttaaagtttgatgaatttaccatagatttaaaggtaaaaccaagtgtatatgaggga
gaaggatgtgtttatctaaagaaaggtaatgaatttggattaagggaaattatgaattat
gataagtctaataatagggctgttgaattttatgtaagagataattctgggatatttgag
acaattgtatttataacacctaaggattgggtgaataattttcatagtgtaagtgcgata
tataaaaataagattatgagattatttatagatgataatttggttggagagaagacattt
aattataatatagcatatttcaaagatggtattcaaattggaggaaatgatggttatact
cactgtgaaagtatgaatgggataatagatgaggttaagttattttctaaaggaatggat
atagaggaattacgtaaaaagagtttttataatatagatgctacaaggataatatggaat
gattttgataatgagagaaatatgattatgaaaaaattatccagagataaatatttggct
acgggaggtgacttcaatgattctccaaatgattctgcattttgtgctaatggtatattg
ttagcatctagaaagattaaaccacaagtaagtgaggttaagtatgcatatcaaaatata
gatattagggattatgatattttaaatggtaaagtaattattaaaaataaaaacttattt
aaaaatttaagagattatatattgaaatgggactatttagttgatggcaaaatagtaaga
ggagatacagctatagttaatgttgatcccatgagtgaaattatatttaatgtacatgat
atggataaaattaaggatttaaatggaaaagaattttttttaaatattggatttgtatta
aatgaaagtacaaattggggtaacagggggtttgaaatatcaaggaatcaattaaaaata
aacttagataatttgttttatgaagtaggtaatgttagcaaggtagttcaaaattttatg
attgatgatttgtcggataaattggaaattaaatctaaagaatattatattggatttaat
aaaatatcaggtactctccaaaattataggtataagaatgaggatttaataaattctgaa
ttatatgttgatttttggaatccattaaatgataacgaaagattatgtaatatatataat
aagatagtattctggaaaaatatatttaatagaagtaggaataatagttacaatattttg
catgaagatggttgtatattggtaaaattttacaaaccaatctatgatttaaataattca
gttcttattacaacatataagatagatgagtacggggaaattagtattgagctatatatg
gagttattaaagaatggtataccgcatgctaggtcagtaggatttaagatatttatacct
actaattttaaaaatattgagtattacggaagaggaccattagaaaattataatgatcga
aataaaggtagtaatttaggagaatataaaagcgatgtagatagtcaatttacagattat
atgactcctcaaagaacagggaatataacagatattagatggataaatttttataggaac
aatggtataggtattagaatcaaatatattaatgaatttcttcaaataaatgttagttca
tataatgatgatgaatttgagaaaaaacattcttatcaaatgaataaatattcgtcaatt
atagtaaatgttagatcaaaggattatggaagcacattcgaaagttttgaagatgaatgt
attaactatattgataaaaatcatatatataatttttcattcaaattatcacctttatta
acggataatgtattaattaattga

DBGET integrated database retrieval system