KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0195Help
Entry
SFBM_0195         CDS       T01591                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFBM_0195
   01230 Biosynthesis of amino acids
    SFBM_0195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_0195
   00051 Fructose and mannose metabolism
    SFBM_0195
   00562 Inositol phosphate metabolism
    SFBM_0195
Enzymes [BR:asf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SFBM_0195
Exosome [BR:asf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SFBM_0195
  Exosomal proteins of bladder cancer cells
   SFBM_0195
  Exosomal proteins of melanoma cells
   SFBM_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210615..211361
Genome map
AA seq 248 aa AA seqDB search
MRKNIIMGNWKMHFTIEETEEFLNSLLPKVKNAKTEVVVCPPFTSLALSSNILKGSNVKL
GAQNVHFEEKGAFTGEISPNMLKNLGVSYIIIGHSERRMYFGETDETVNKKIHMCLKHKF
NPVLCVGESLEEKESNNMEKVLTRQIEKAFFNISEEDAKKVVIAYEPIWAIGTGKTATSS
DADNIISFIRKVISGIYNKEVSENIVMLYGGSVKPNTIKEQMSMENIDGALVGGASIVVE
DFERIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaagaatataataatgggaaactggaaaatgcattttacaattgaggaaactgaa
gaatttttaaatagtttgttacctaaagttaagaatgctaaaactgaagttgttgtgtgt
cctccatttacttctcttgctttatcttcaaatatacttaagggttcaaatgtaaaatta
ggtgctcaaaatgtacattttgaggaaaaaggagcatttactggtgaaatttccccaaat
atgcttaagaatttaggagtttcttatattataataggtcatagtgagagaaggatgtac
tttggagaaacagatgagacagttaataaaaagatccatatgtgcttaaaacataaattt
aacccagttttatgtgttggagagagtttggaagaaaaagaaagtaataacatggagaaa
gtattgactcgtcaaatagaaaaagccttttttaatatatctgaggaagatgcaaaaaaa
gttgtaattgcatatgaaccaatatgggctattggaactggcaagacagcaacaagttct
gatgctgataatataatttcttttataagaaaagttattagtggtatttataataaagaa
gtgtctgagaatatagttatgttatatggtggatcagttaaacccaatactataaaagag
caaatgtctatggaaaatatagatggtgctttggttggtggagcttctatagttgttgaa
gattttgaaaggattgttaatttttag

DBGET integrated database retrieval system