KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0195Help
Entry
SFBM_0195         CDS       T01591                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFBM_0195
   01230 Biosynthesis of amino acids
    SFBM_0195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_0195
   00051 Fructose and mannose metabolism
    SFBM_0195
   00562 Inositol phosphate metabolism
    SFBM_0195
Enzymes [BR:asf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SFBM_0195
Exosome [BR:asf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SFBM_0195
  Exosomal proteins of bladder cancer cells
   SFBM_0195
  Exosomal proteins of melanoma cells
   SFBM_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210615..211361
Genome map
AA seq 248 aa AA seqDB search
MRKNIIMGNWKMHFTIEETEEFLNSLLPKVKNAKTEVVVCPPFTSLALSSNILKGSNVKL
GAQNVHFEEKGAFTGEISPNMLKNLGVSYIIIGHSERRMYFGETDETVNKKIHMCLKHKF
NPVLCVGESLEEKESNNMEKVLTRQIEKAFFNISEEDAKKVVIAYEPIWAIGTGKTATSS
DADNIISFIRKVISGIYNKEVSENIVMLYGGSVKPNTIKEQMSMENIDGALVGGASIVVE
DFERIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaagaatataataatgggaaactggaaaatgcattttacaattgaggaaactgaa
gaatttttaaatagtttgttacctaaagttaagaatgctaaaactgaagttgttgtgtgt
cctccatttacttctcttgctttatcttcaaatatacttaagggttcaaatgtaaaatta
ggtgctcaaaatgtacattttgaggaaaaaggagcatttactggtgaaatttccccaaat
atgcttaagaatttaggagtttcttatattataataggtcatagtgagagaaggatgtac
tttggagaaacagatgagacagttaataaaaagatccatatgtgcttaaaacataaattt
aacccagttttatgtgttggagagagtttggaagaaaaagaaagtaataacatggagaaa
gtattgactcgtcaaatagaaaaagccttttttaatatatctgaggaagatgcaaaaaaa
gttgtaattgcatatgaaccaatatgggctattggaactggcaagacagcaacaagttct
gatgctgataatataatttcttttataagaaaagttattagtggtatttataataaagaa
gtgtctgagaatatagttatgttatatggtggatcagttaaacccaatactataaaagag
caaatgtctatggaaaatatagatggtgctttggttggtggagcttctatagttgttgaa
gattttgaaaggattgttaatttttag

DBGET integrated database retrieval system