KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0287Help
Entry
SFBM_0287         CDS       T01591                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00010  Glycolysis / Gluconeogenesis
asf00052  Galactose metabolism
asf00500  Starch and sucrose metabolism
asf00520  Amino sugar and nucleotide sugar metabolism
asf00521  Streptomycin biosynthesis
asf01100  Metabolic pathways
asf01110  Biosynthesis of secondary metabolites
asf01120  Microbial metabolism in diverse environments
asf01130  Biosynthesis of antibiotics
asf01200  Carbon metabolism
Module
asf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_0287
   00052 Galactose metabolism
    SFBM_0287
   00500 Starch and sucrose metabolism
    SFBM_0287
   00520 Amino sugar and nucleotide sugar metabolism
    SFBM_0287
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SFBM_0287
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SFBM_0287
Enzymes [BR:asf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SFBM_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAK56066
UniProt: F9VIF4
Position
330971..331909
Genome map
AA seq 312 aa AA seqDB search
MDLKYCLSFDIGGTFIKYAIIDNEGVIHEKDKINTPGYPARETIPAALIDIFEKLKLKFN
IICVGVSTAGQVDVDKCEVIYATDNIPGYIGTNFRDILAKKFNLDVFADNDVNSAAIGEM
WLGSAKDAKNFLCMTLGTGVGGAIIIDNKLHRGNNYSAGEIGHFIIFPNGDKCTCGLNGC
YERYASTSALIKMYKEELIKNNMICKDNYTGEYIVDLCYRGDSIASSVYNRFLDYIAYGI
ANLVHILDIGLVIVGGGISEQGDLFFNEINNRFKKYVLNVYKNGTIIKQAGLKNDAGVIG
AAFNTFSYINIM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatttgaaatattgtttatcatttgatataggtggaacatttataaaatatgctatt
attgataatgaaggagtaatccatgaaaaagataagattaatacgcctggatatccagca
cgagagactatacctgctgcattaattgatatatttgaaaaattaaaattaaaatttaac
atcatttgtgtaggagtatccacagcaggtcaagtagatgttgataaatgtgaagtaata
tatgcaacagataatataccaggatatattgggactaattttagagatattttagcaaag
aaatttaatttagatgtgtttgcagataacgatgttaattcagcagctattggggaaatg
tggctcggaagtgctaaagatgctaaaaactttttatgtatgacattgggaactggagtt
ggtggtgctattataatagataataaattgcatagaggtaataattattcagcaggtgag
ataggacattttattatttttccaaatggagataaatgtacttgtggtttgaatggatgt
tatgaaagatatgcctctacatctgctttaattaagatgtataaggaagaattgattaaa
aataatatgatatgtaaagataattatacgggtgagtacatagttgatttgtgttatagg
ggggatagtatagccagttcagtttataatagatttttagattacatagcatatggtata
gcaaatttagttcatattttagatattggacttgtaatagttggtggcggtatatcagaa
caaggagatttattttttaatgaaataaataataggtttaagaaatatgtacttaatgtt
tataagaatggtactataataaaacaggctggactcaaaaatgatgctggagttattggt
gcagcttttaatacattttcctatataaatattatgtaa

DBGET integrated database retrieval system