KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0452Help
Entry
SFBM_0452         CDS       T01591                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:asf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(487520..488002)
Genome map
AA seq 160 aa AA seqDB search
MIKLIACIDKYSSLGINNNLIYFIKEDLKIFKEKTINNIVVMGRKTFNSLNNKPLPNREN
IIISRNLCNPKDKSYTVFNDINSVLKLNTPKDIFIIGGSKIYKYFTDFYDEIHLTMIKDK
YTKVYPINQSVKLNIQLNNFKLIDQKEYDIFFIKIYQRIK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactaattgcatgtatagacaagtacagttcactaggcataaataataatctc
atttatttcatcaaagaagatttaaaaatcttcaaagaaaaaactattaataatatagtc
gtcatgggtagaaaaaccttcaatagtttaaataacaaacctcttccaaatagagaaaat
ataattatatctcgaaatttatgtaatcctaaggacaaatcttatactgtcttcaatgat
ataaatagtgttttaaaactaaatacaccaaaagatatctttataataggaggaagtaaa
atatataaatattttacagatttctatgatgaaatacacttaacaatgataaaagataaa
tacaccaaagtctaccctataaatcagtccgtaaaattaaatatacaattaaataacttt
aaacttattgaccaaaaagaatatgatatattttttataaaaatatatcagaggattaaa
taa

DBGET integrated database retrieval system