KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0566Help
Entry
SFBM_0566         CDS       T01591                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFBM_0566
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SFBM_0566
Enzymes [BR:asf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SFBM_0566
Two-component system [BR:asf02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SFBM_0566
Bacterial motility proteins [BR:asf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SFBM_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620308..621321
Genome map
AA seq 337 aa AA seqDB search
MKYRDQIIKTKLIIYDESNLMRKLVYDRLAKDAGINIIDIFDDYDEMKNFILGSGIVLDV
IILNQSFYENGDFIKYLLDLKNFAVNLIVISNLDDSTISFIERTVGAEKLIFIRCLNKSG
LKDIFDIKEKLIDVVYGIKNSRIKRAIFDVQKAIVIASSTGGPKVLEYIFGNLETKIDMP
VFIVQHMPEGHTKHFVDRLGELCSYKVCEGKNGEIAMANVVYVAPSGYHMEIDNKKQINL
NGNKPLNNVRPSADALFCSASKIYKKGLLGIVLTGMGRDGSDGIRYIKINGGITIAQDEG
SSTVFGMPKSAIETGMVDKVLSKDEILFEIVKHSGKL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatatagagatcaaattataaaaacaaaacttattatatatgatgaatcaaattta
atgagaaaacttgtatatgacagattggctaaggacgctggaataaatattatagatatt
tttgatgattatgatgaaatgaaaaatttcatcttgggttcaggcattgtattagatgta
ataattttgaatcaatcgttttatgagaatggagattttattaaatatttattagattta
aaaaattttgctgttaatttaatagtaatatcgaatcttgatgacagtacaatttcattt
atagagcgaactgtaggagctgaaaaattaatatttataagatgtttaaataaatcagga
ttaaaagatatttttgacataaaagaaaaattgatagatgtagtctatggaataaaaaat
agccgtattaagcgtgctatatttgatgtgcaaaaagctatagtaattgcatcatcaacg
ggtggaccaaaagtgttagaatatatatttgggaatttggaaaccaaaatagatatgcct
gtatttatagttcaacatatgccagaaggtcatacgaaacactttgttgatagattgggt
gaactttgtagttacaaagtttgtgaagggaaaaatggagaaattgcaatggctaatgtg
gtttatgttgcaccaagtggttatcatatggaaattgacaacaaaaaacagattaattta
aacggtaacaaaccattaaataatgttagaccatctgctgatgctttgttttgttcagca
tctaagatttataaaaaaggtcttttaggaatagtactaactggaatgggtagagatggt
tctgatggaattaggtatataaaaataaatggagggattactatagctcaagatgaggga
agtagcactgtttttggaatgcctaaatcagcaattgaaactggaatggtagataaagtt
ttatcaaaagatgaaatattatttgagattgttaaacattcaggtaaactatag

DBGET integrated database retrieval system