KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0593Help
Entry
SFBM_0593         CDS       T01591                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00030  Pentose phosphate pathway
asf00051  Fructose and mannose metabolism
asf01100  Metabolic pathways
asf01110  Biosynthesis of secondary metabolites
asf01120  Microbial metabolism in diverse environments
asf01130  Biosynthesis of antibiotics
asf01200  Carbon metabolism
asf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFBM_0593
   00051 Fructose and mannose metabolism
    SFBM_0593
Enzymes [BR:asf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SFBM_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB NUP214
Motif
Other DBs
NCBI-ProteinID: BAK56371
UniProt: F9VJV9
Position
645474..645923
Genome map
AA seq 149 aa AA seqDB search
MNIYISSDHAGYELKFNLVSMLIEEFKNHEVFDCGPYSEELVDYPTFAEKVCENVLFNEG
SLGILICGTGIGMSIAANKIKGIRAALCNDIFSARLARQHNNANVLVLGSRVIGNGLAQE
IVTSFLQSEFEGGRHSERLALIKNLENRN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatatatttcatcagaccatgcaggatatgaacttaagtttaatttggtttca
atgttaatcgaggaattcaaaaatcatgaagtatttgactgtggaccatattcagaagaa
ttagttgattatccaacatttgctgaaaaagtttgtgaaaatgttttatttaatgagggt
tctttaggtatattgatatgtggcacaggcattgggatgagtattgcagctaataagata
aaaggaataagagcagctttgtgtaatgacatatttagtgctagacttgcaaggcaacat
aataatgcaaatgtcttagttcttggatcaagggtaatagggaacggtttagctcaagaa
attgtaacatcttttttacaaagtgagtttgaaggtggaagacatagcgaaagattagcg
ttaataaaaaatttagaaaatagaaactaa

DBGET integrated database retrieval system