KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0593Help
Entry
SFBM_0593         CDS       T01591                                 

Definition
(RefSeq) ribose 5-phosphate isomerase
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFBM_0593
   01230 Biosynthesis of amino acids
    SFBM_0593
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFBM_0593
   00051 Fructose and mannose metabolism
    SFBM_0593
Enzymes [BR:asf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SFBM_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645474..645923
Genome map
AA seq 149 aa AA seqDB search
MNIYISSDHAGYELKFNLVSMLIEEFKNHEVFDCGPYSEELVDYPTFAEKVCENVLFNEG
SLGILICGTGIGMSIAANKIKGIRAALCNDIFSARLARQHNNANVLVLGSRVIGNGLAQE
IVTSFLQSEFEGGRHSERLALIKNLENRN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatatatttcatcagaccatgcaggatatgaacttaagtttaatttggtttca
atgttaatcgaggaattcaaaaatcatgaagtatttgactgtggaccatattcagaagaa
ttagttgattatccaacatttgctgaaaaagtttgtgaaaatgttttatttaatgagggt
tctttaggtatattgatatgtggcacaggcattgggatgagtattgcagctaataagata
aaaggaataagagcagctttgtgtaatgacatatttagtgctagacttgcaaggcaacat
aataatgcaaatgtcttagttcttggatcaagggtaatagggaacggtttagctcaagaa
attgtaacatcttttttacaaagtgagtttgaaggtggaagacatagcgaaagattagcg
ttaataaaaaatttagaaaatagaaactaa

DBGET integrated database retrieval system