KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0593Help
Entry
SFBM_0593         CDS       T01591                                 

Definition
ribose 5-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:asf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:asf01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:asf00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:asf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645474..645923
Genome map
AA seq 149 aa AA seqDB search
MNIYISSDHAGYELKFNLVSMLIEEFKNHEVFDCGPYSEELVDYPTFAEKVCENVLFNEG
SLGILICGTGIGMSIAANKIKGIRAALCNDIFSARLARQHNNANVLVLGSRVIGNGLAQE
IVTSFLQSEFEGGRHSERLALIKNLENRN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatatatttcatcagaccatgcaggatatgaacttaagtttaatttggtttca
atgttaatcgaggaattcaaaaatcatgaagtatttgactgtggaccatattcagaagaa
ttagttgattatccaacatttgctgaaaaagtttgtgaaaatgttttatttaatgagggt
tctttaggtatattgatatgtggcacaggcattgggatgagtattgcagctaataagata
aaaggaataagagcagctttgtgtaatgacatatttagtgctagacttgcaaggcaacat
aataatgcaaatgtcttagttcttggatcaagggtaatagggaacggtttagctcaagaa
attgtaacatcttttttacaaagtgagtttgaaggtggaagacatagcgaaagattagcg
ttaataaaaaatttagaaaatagaaactaa

DBGET integrated database retrieval system