KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0596Help
Entry
SFBM_0596         CDS       T01591                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SFBM_0596
Enzymes [BR:asf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SFBM_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646604..647221
Genome map
AA seq 205 aa AA seqDB search
MDEMYNKGLLIVLSGPSGVGKGTVCKELMKKYDYKVSISATTRSPREGEVDGVNYYFLDK
DTFKSKIENNEFLEYAEVYGNYYGTLKSQVEEELSRGNNIILEIDIQGSMQVQSVFENAV
YIFLLPPSINELKSRILKRGSETESSFNLRFSSVSEELKCMVNYDYAVINDDVEGAVEKI
NGIIRTEMSRISRMNLEKFIGGYIF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgtacaataagggattattgattgttctttctggaccttctggtgtcggg
aaaggtacggtttgtaaagaacttatgaaaaagtatgattataaggtttctatttctgct
actactaggtctccgagagaaggagaagttgatggagttaattattattttttagataag
gatacctttaaatcaaagattgaaaataatgaatttttagagtatgctgaagtttatggg
aattattatggtacgcttaaaagtcaagttgaagaagagttaagtagagggaataatatt
atacttgagattgatattcaggggagtatgcaggtgcaaagtgtttttgaaaatgcagtg
tacatatttttattaccaccgtctataaacgagcttaaaagtaggattttgaaaagagga
agtgaaactgaatcttcgttcaatttaagattttcttcagttagtgaagaattaaaatgt
atggttaattatgattatgcagttataaatgatgatgttgagggtgcagttgagaaaata
aatggtataataaggactgaaatgagtagaataagtagaatgaatttagaaaaatttatt
ggtggatatattttttag

DBGET integrated database retrieval system