KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0626Help
Entry
SFBM_0626         CDS       T01591                                 

Gene name
ackA
Definition
acetate kinase
Orthology
K00925  
acetate kinase [EC:2.7.2.1]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:asf01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:asf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:asf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:asf00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:asf00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676744..677940
Genome map
AA seq 398 aa AA seqDB search
MKILVINCGSSSLKYQLIDMNTENAIAKGLVERIGIPGSNLEQKVDGSNEKYKVEVDLKN
HKEAIALVLKTLCDDRFGLIKDLSEINAIGHRVVHGGEKYSKSVIVDEEVIKNIEECIKL
APLHNPANLIGIKACRELMKDTPMVVVFDTAFHQTISDKAFMYGLPYELYEKYSIRKYGF
HGTSHFYVANECARAMGKSIEDLKIITCHLGNGASVSAVNAGKSVDTSMGFTPLQGLMMG
TRCGDIDPAVVTFLIDELNMSGKEVNELMNKKSGFLGVSGKSSDSRDIEDLAQQGDKRAK
LTLDMYCYRIKSYIGSYIAAMNGVDAIVFTAGIGENSAITRYGVCKDMESLGIIIDENKN
NVRGKLTEISADNSKVKIYLIPTNEELVIARDTQDLLK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttagttataaattgtgggagttcttccttaaaatatcaattgattgatatg
aatacagaaaatgcaattgcaaaaggattagttgagaggataggaatacctggatctaat
cttgagcaaaaagttgatggatctaatgaaaaatataaagtggaagttgatcttaaaaat
cataaagaggctatcgcattagttttaaaaacactatgtgatgatagatttggtttaata
aaagatttaagtgaaattaatgctattgggcatagagtggttcatggaggagaaaaatat
tcaaaatctgttattgtggatgaggaagttattaaaaatatagaagaatgtattaaactt
gctccacttcataatcctgcaaatctcattggaataaaagcgtgcagagaattgatgaaa
gatactcctatggttgttgtgtttgacacagcatttcatcaaacaatttcagataaagct
tttatgtatgggttaccatacgagctctatgagaagtattcaataagaaaatatggattt
catggaacaagtcatttttatgttgcgaatgaatgtgcaagagctatgggtaaaagcata
gaagatttaaaaataataacttgtcatttaggaaatggtgctagtgttagtgctgttaat
gccggtaagagtgttgatacatcaatgggatttacacccctacagggtttaatgatggga
acaagatgtggggatatagatcctgcggttgtaacatttttaatagatgagcttaatatg
agcggaaaagaagttaatgaacttatgaataaaaaatctggattccttggagtttcaggg
aaaagcagtgattcaagagatattgaggatttagcacaacagggtgataagagagctaag
ttaactttagatatgtattgttatagaattaagtcttatattgggtcttatattgctgcg
atgaatggagtagatgctatcgtatttactgcgggtataggtgagaattccgcaattaca
agatatggtgtttgtaaagatatggagagccttggaattataattgatgagaataaaaat
aatgtaaggggaaaattgactgaaatttctgcagataattctaaagttaagatttattta
attccaacaaatgaggaacttgttatagcaagagatactcaggatttattgaagtaa

DBGET integrated database retrieval system