KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0996Help
Entry
SFBM_0996         CDS       T01591                                 

Definition
(GenBank) beta-d-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
asf00010  Glycolysis / Gluconeogenesis
asf00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_0996
   00500 Starch and sucrose metabolism
    SFBM_0996
Enzymes [BR:asf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SFBM_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: BAK56762
UniProt: F9VKV4
Position
complement(1056007..1057383)
Genome map
AA seq 458 aa AA seqDB search
MIKFPNNFYYGSATSATQSEGSHDDGLKGQDIWDIWYEEEPYKFFGGVGPKDTSTFYKNY
KSDIKLLKQTGHNSFRTSISWSRLFPNGYGKLNQDAVKFYRNVFEELKNEGIEPFVCLFH
FDMPYELQKIGGWENRKVVDYYRDYAKKCFELYGDIVKHWFTFNEPIVHVECGYLLCYHY
PCKVDPKAAVQVAYHTALASASAIKEYHTLNQGGKIGIVLNLTPAYPRSDNPKDVDASRI
AELFANKSFLDPAVKGEYSKELFNIIKKHDLMPTYTEEDLKTIKENTVDFLGVNYYHPVR
VCAKANMPNPDAPFFPQYYFDDYIMPGRKINPHRGWEIYPKGLYDIAINIKDNYGNIEWM
VTENGMGVEGEERFKKDGRIEDDYRIDFYKEHLSWLHKGISEGSNCIGYQVWTFIDCWSW
INAYKNRYGLIELNIDTQERIIKKSGYWFKELHDNNGF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgattaagtttccaaataatttttattatggtagtgctactagtgcaactcagagcgaa
ggatctcatgacgatggtttaaagggacaagatatatgggatatttggtatgaggaagag
ccatataaattttttggtggtgttggaccaaaagatacatcaactttttataaaaattat
aaatctgatataaaattactaaagcagacaggccataattcctttagaacatctataagt
tggtcaagattgtttccaaatggatatggtaaattaaatcaagatgccgtaaaattttat
cgcaatgtatttgaggaactgaaaaatgaaggaatagaaccttttgtatgcttgtttcat
tttgatatgccatatgaactccaaaaaattggaggatgggaaaatagaaaagttgtagat
tattacagagattatgcaaagaaatgtttcgaactttatggagatatagttaaacattgg
tttacatttaatgaaccaattgtacatgttgaatgtgggtatttactttgttatcattat
ccatgcaaggttgatccaaaagctgcggttcaagttgcgtatcatacagcacttgcaagt
gcatctgcaataaaggagtatcacacactaaatcaaggtgggaaaattggaatagtactt
aatcttaccccagcatatccaagaagtgataacccaaaagatgttgatgcttcaagaatt
gctgagctatttgcaaataagagttttttagatccagcagttaaaggggagtatagcaaa
gagttatttaatataatcaaaaaacacgatttgatgccaacatatacagaagaagatcta
aaaactataaaagaaaacacggtagactttttaggagttaattattatcatccggttaga
gtttgtgcaaaagcaaatatgccaaacccagatgctcctttctttccacagtattatttt
gatgattatataatgccaggaagaaaaattaatccacacaggggttgggaaatttatcct
aaaggattgtatgatattgctataaatataaaagataattatgggaatattgaatggatg
gtaactgaaaatggaatgggagttgaaggtgaggaacgtttcaaaaaagatggacgcatt
gaggatgattatagaatagatttttataaagaacatttaagttggttacacaaaggaatt
agtgaaggaagtaattgtattgggtatcaggtttggacatttatagattgttggagttgg
ataaacgcatacaaaaatagatatggattaatagaactcaatattgatactcaagaaaga
ataattaaaaagtctggttattggtttaaagaattacatgataataatgggttttaa

DBGET integrated database retrieval system