KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_1269Help
Entry
SFBM_1269         CDS       T01591                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SFBM_1269
Enzymes [BR:asf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SFBM_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1372725..1374953)
Genome map
AA seq 742 aa AA seqDB search
MKKLIGAIKNIIYTSVKFSIFILVDDEGKEIICVYNDNNINRNDYVEVNGNFEINGKYGE
RFKVSFLEKRILSVTNDIESYLSSSLFVGIGRKTAKKIIEKFGDQTLDIINNYTERLKEV
EGIGEKKFLEIKSALNRDKNDKEIILDLINIGFSLNNANKIYSLFREEAVNIIREDPYML
IGKINGFGFKKVDLIGKKLNIPNENSNRVRSGIFYVLKDNLKFGNTFILYNEMIEKSKEL
LCISEEKIIEVYNDILSCGIIVEKEFNYENSNIKCVFLTNIYMAEYEICSNLIRLYIGYK
DKFNIDIYRDILEFENKNDFKFSEDQIEALVGGIKNGVHIITGGPGTGKTTIIKFILSTL
LNYGFNPIMVAPTGRAAKRMMETTGFEAKTIHRVLEISTSDNEEFGYIGKNENNKIKCDA
IIIDEASMVDVLIASKLFEALKIGTKIVIVGDVDQLPSIGPGNFLRDIINSGIFPVSYLN
KIYRQKQNSFIVLNAHKINNGEELILNKKDSDFYIIKDSSEENICKILVDLVSFRIPKFF
EYKIDKLKDIQILSPIRGGVLGVSNLNSLLQENINPKDINKDELIYGGKCYRVGDKVMQI
KNNYEIRGYNIHDEEQAIGVFNGDIGYIIDINEKELSIIYDDSKVFKYTKNLLSEIEHAY
AITIHKSQGSEFPVIILPIFKFSSMLMNRNILYTAVTRAKKYVVLVGDINYLTYMIKNTS
KIIRYSSLKYLFNEVINLLDKN
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaataggtgctattaaaaatattatttatacttctgttaagttctctata
tttatacttgtagacgatgaaggtaaagaaataatatgtgtatataatgataataatatt
aatagaaatgattacgtggaagttaatgggaattttgaaatcaatggtaaatatggtgag
agatttaaagtttcctttttagagaagaggattttaagtgttacaaatgacatagagagt
tatttatcgtcttctttatttgttggaattggtaggaaaacagctaagaaaataattgag
aagtttggagatcaaactcttgatataataaataattatactgaaagattaaaagaagtt
gaaggtattggggaaaagaagttcttagagataaaaagtgctttgaatagagataaaaat
gataaagagataattttagatcttataaatattggattttctttaaataatgcaaataaa
atttatagtttatttcgtgaagaagctgtaaatattattcgtgaggatccatatatgctt
ataggaaagattaatggatttggatttaagaaggtggatttaataggaaagaaactaaat
ataccaaatgagaattcaaatagggttagaagcggtatattttatgtgcttaaggataat
ttgaaatttggaaatacatttatattatataatgagatgattgagaaaagtaaagagtta
ttatgtatttctgaagaaaaaataattgaagtttataatgatattttatcatgtggtatt
attgtagagaaggaatttaactatgaaaatagtaatataaaatgtgtttttttgacaaac
atatatatggcagaatatgagatatgttcaaatttaattaggttatatataggatataag
gataaatttaatattgatatctatagagatatacttgagtttgagaataagaatgatttt
aaattttcggaagatcagattgaggcactagttggcggtataaaaaatggtgtgcatata
ataacgggtggacctggtacagggaaaacaactataataaaatttattttaagcacactt
cttaattatggatttaatccaataatggttgcaccaactgggagagcagcaaaaagaatg
atggaaactacaggatttgaagctaaaactatacatagagttcttgaaatttcaactagt
gataatgaagagtttggatatatagggaaaaatgaaaataataaaataaagtgtgatgct
ataataatagatgaagcatcaatggttgatgttttgattgcaagcaaattatttgaagca
ttgaaaataggaacaaagatagtaatagttggagatgttgatcaacttccatcaattggt
cctggaaattttttaagagatataataaacagtggtatatttccagtttcatatttaaat
aaaatatataggcaaaagcaaaatagttttatagttttgaatgctcataagattaataat
ggagaggaacttatattaaacaaaaaagatagtgatttttatattataaaagatagtagt
gaggagaatatatgtaaaattttagtagatttagtatcttttaggatacctaaattcttt
gaatataagattgataagttaaaagacatacagattttatctccaataagaggaggagta
ttgggagtttcaaatcttaatagtttacttcaagagaacataaatccaaaggatattaat
aaggatgaattaatatatgggggaaaatgttatcgagttggagataaggttatgcagatt
aaaaataattatgagattagaggatataatatacatgatgaagaacaagcaataggagtg
tttaatggggatattgggtatattatagatataaacgaaaaagaattaagtattatatat
gatgacagtaaggtgtttaaatatacaaagaatttattaagtgaaattgaacatgcttat
gctattactatacataaaagtcaagggagtgaatttccagttattatattgcctatattt
aaattctctagtatgctgatgaatagaaatatattgtatacagcggttactagagctaaa
aaatatgttgtattagttggtgatataaattatttaacatatatgataaaaaatacttca
aagattattagatattcatctttaaaatacttatttaatgaagtgattaatttattagat
aaaaattag

DBGET integrated database retrieval system