KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_1293Help
Entry
SFBM_1293         CDS       T01591                                 

Definition
4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:asf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399358..1400218)
Genome map
AA seq 286 aa AA seqDB search
MKLRSYGKINIFLNILGKRKDGYHDIETLIQRIDLFDDIYLKVDKEFEGVYIEIECDNHQ
IPIDHRNLCYKACMWFIEKYGLKGKIYIKIHKNIPVCSGLGGGTSNGAEIIKALNYIYKL
DIPIDVLCRDSIVLGADFPYCILGGSVLCEGIGEKVTKLKSFEDKIILIIKPDFGFSTKD
VYNKFNLYNIKYNINKDMIINYLNNDKFYDVCNNISNILEYSDVENMDVIRDMKYRLINS
GAINASMSGSGSAVYGVFDNLYLAQRSYDIFKKEFNEVFLTKTINE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaggagttatggcaagattaatatttttttaaatattttggggaaaagaaaa
gatggatatcatgatattgaaacattgattcagagaattgatttgtttgatgatatatat
ttaaaagtagataaagagtttgaaggagtatacatagaaatcgaatgtgataatcatcaa
atacctatagatcataggaatttgtgctataaagcttgtatgtggtttatagaaaagtat
ggtttgaaggggaaaatatatataaaaatacataaaaatatacccgtatgttcaggcctt
ggtggtgggacaagtaatggagctgaaataataaaagccttaaactatatatataaatta
gatattcctatagatgttttatgtagggatagtattgtattaggtgctgattttccttat
tgtattttaggaggaagtgttttatgtgagggtataggagagaaagtaacgaaattaaaa
tcttttgaagataaaataattttaattataaaacctgattttggtttttctactaaagat
gtttataataaatttaatttatataatataaaatataatataaacaaggatatgatcatt
aattatttgaataatgataagttctacgatgtttgtaataatatttcaaatatattggaa
tattcggatgtagagaatatggatgttatacgagatatgaaatatagattaataaatagt
ggtgccattaatgcttctatgagtggtagcgggtcagcagtatatggagtttttgataat
ttatatttagctcaacgctcgtatgatatatttaaaaaagaatttaatgaagtattttta
acaaaaactattaatgagtag

DBGET integrated database retrieval system