KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_1344Help
Entry
SFBM_1344         CDS       T01591                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SFBM_1344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFBM_1344
   00620 Pyruvate metabolism
    SFBM_1344
   00650 Butanoate metabolism
    SFBM_1344
  Lipid metabolism
   00071 Fatty acid degradation
    SFBM_1344
  Amino acid metabolism
   00350 Tyrosine metabolism
    SFBM_1344
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SFBM_1344
   00626 Naphthalene degradation
    SFBM_1344
Enzymes [BR:asf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SFBM_1344
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SFBM_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465979..1468585
Genome map
AA seq 868 aa AA seqDB search
MKSKNQIQEKETSNISLVINSLVNNAKKAEQKLLKLNQNQIDKIVSAMCIAGADKNIELS
KLAIEETKRGVFEDKVIKNLFATEYIHHDIKHIKTVGIINDDPTKDYFNVAEPVGIIAGV
TPVTNPTSTAMFKAIISIKTRNPIIFAFHPSAQKCSSEAARVVYEAAISAGAPEHCIQWI
NEPSIEATNLLMNHPEIALILATGGSGMVKSAYSCGKPALGVGPGNVPAYLEKTCNLQRA
VSDIIISKTFDNGMICASEQTAVVDEEISKYFEKLMKELNCHLCSEDEIKKLEKYAFPED
KNSCVLNANIVGKSANEIAKEAGFEVPEKTKILIAKIDSIGPNSPLSREKLSPILSYIIV
KNSDEGIEKSCQIVEFGGLGHSAAIHSSNEDIIKKFSEKVKAGRIVVNSPSTHGAIGDLY
NSNRASLTLGCGSYGKNSIISNVTCENLINLKRVARRKTNMQWFKIPKKIFFEWGSTSYL
EKMPDISKIMIITDAGMVNLGYADIVVNHLNNRIDKVSIEIFSDVEPDPSVETVFNGVKA
MNRFKPDCIIALGGGSAIDAAKSMWLFYEHPEINFNDIKLKFVDIRKRIYKFPKLGNKAQ
LVAIPTTSGTGSEVTSFSVISDKTKNIKYPLADYELTPNVAIIDPQFVMSLPKSVTADTG
LDVLTHAIEAYVSILASDYTDALAIKAIQLVFEYLPRAFKNGNNDKVAREKMHNASSIAG
MAFTNAFLGINHSLAHKLGGEFHIPHGRANAILLPHVIKFNSETPTKLPSFPKYEKFIAH
EKYAEISRSLGLKASTTEEGVNSLISAIKKLMSELEMPTKISECNINKEEYMSKIELLAL
KAFDDQCTGANPRYPLVEELHEIYKNIY
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaaatcaaatacaagaaaaagaaacttcaaatataagcttagttattaat
tctctagtaaataatgctaaaaaagctgaacaaaaacttttgaaattaaatcaaaatcaa
atagataaaattgtatcagctatgtgtattgctggtgctgataaaaacatagaattatca
aaattagctatcgaagaaactaaacgtggagtttttgaagacaaggttattaaaaacctt
tttgctactgaatacattcatcatgatattaaacatattaaaactgttggaattataaat
gatgatccaactaaagattattttaatgttgctgaaccagttggtattatcgctggggtt
actccagttacaaatccaacatcaactgctatgtttaaagctataatatcaatcaaaaca
agaaatccaataatatttgcattccatccgtccgcccaaaaatgtagttcagaagctgct
agagtagtttatgaagctgctatatctgctggggctccagaacactgcattcaatggata
aacgaaccatccatcgaagctactaatttactaatgaatcatccagaaatagctctcatt
ttggcaacaggtggatccggaatggttaaatctgcatatagttgtggaaaacctgcttta
ggagttggccctggaaatgttccagcttatcttgagaaaacttgtaaccttcagagagct
gtatcagatatcatcatatccaaaacttttgataatggtatgatttgtgcatcagaacaa
actgctgtagtagatgaagaaatctcaaaatattttgaaaaattaatgaaagaattaaat
tgccatttatgttctgaagatgaaattaaaaaactcgaaaaatatgcatttcctgaagac
aaaaactcttgtgtcttaaatgccaatatagtcggaaaatcagctaatgagatagctaaa
gaagctggttttgaagttcctgaaaaaacaaagatattaattgcaaaaatagattctata
ggccctaactctcctctatcacgtgaaaaattaagtcctattctctcatatatcattgtt
aaaaactctgatgaaggaatcgaaaaatcttgccaaatagtcgagtttggaggtcttgga
cattctgcagctattcattcatccaatgaagatattattaaaaagttctcagaaaaagtt
aaagctggaagaatagttgtaaactcaccatcaactcatggagctataggtgatttatat
aattcaaatagagcatccctaacattaggatgtggttcttacggtaaaaattcgataata
tctaatgttacatgtgagaatttaatcaatctaaagagagtcgcaaggagaaaaactaat
atgcaatggtttaaaataccaaagaaaatattcttcgaatggggttctacctcataccta
gaaaaaatgcctgatatatctaaaataatgataattactgatgctggaatggtcaatctt
ggatatgcagatatagttgtaaatcacttaaataacagaatagataaagtaagtattgaa
attttctctgatgttgaaccagatccatctgttgaaactgtatttaatggtgttaaagct
atgaacagatttaaacctgattgtatcattgctttaggtggaggatctgcaatagatgcc
gcaaaatctatgtggttattctatgaacacccagaaataaacttcaatgatataaaacta
aaatttgttgatattagaaaaagaatttacaaattccctaaacttggtaataaagctcaa
ttagttgcaatacctacaacatctggaacaggatcagaagttacttcattctcagtaatt
agtgataaaactaaaaatatcaaataccctctagctgattatgaattaactcctaatgta
gctataatagatcctcaatttgttatgagcttgccaaaatctgttacagcagacactgga
cttgatgttttaactcatgcaattgaagcatatgtttcaatattagcatcagattataca
gatgccttagctataaaagctatacaattagtatttgaatacttaccaagagcatttaaa
aatggaaataatgataaagtcgctcgtgaaaaaatgcataacgcttcttctatagctgga
atggcatttacaaacgcctttctaggtataaatcactcacttgctcataaacttggagga
gaattccatatacctcatggacgtgcaaatgctatactcttacctcatgtaattaaattt
aactctgaaacaccaacaaaacttccatcattccctaaatatgagaagtttattgcacat
gaaaaatatgcagagatttcaagatctctaggacttaaagcttctactacagaagaaggt
gttaatagtctaattagtgctattaaaaagcttatgagtgaacttgaaatgccgacaaaa
atttctgaatgtaatataaataaagaagaatatatgagcaaaatagaattacttgctctc
aaagcattcgatgatcaatgtactggggcaaatccaagatatcctcttgttgaagaatta
cacgaaatatacaaaaatatatactaa

DBGET integrated database retrieval system