KEGG   Alistipes shahii: AL1_01180Help
Entry
AL1_01180         CDS       T02578                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ash  Alistipes shahii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL1_01180
Enzymes [BR:ash01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AL1_01180
Exosome [BR:ash04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL1_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149745..151781
Genome map
AA seq 678 aa AA seqDB search
MEKTTRRLPIVERDEWLQPVEAQMNLRHERYERKMADIGRSAGSLVDYANGYRYFGWQWD
DVLDGWWLREWLPGAHDVYVFGDFNNWQRTEIRMHKDAAGVWSAFFPAAMYRDRLRHGSL
YKIHVHGDNGWLDRIPAYARRVVQDDETKNYTAQFWNPAEPFDWRGDAFDASKIGSLLIY
EAHVGMAQEREGVGTYREFTEKILPIIKKDGYNAVQLMAVAEHPYYGSFGYHVSSFFAPS
SRCGTPEELKELIRRAHELGLAVIMDLVHAHYVKNLNEGINSLDGTDHLYSPPGDAGYQQ
YWDSKLFDYGKEEVQHFLLSNVKYWLDEFHFDGYRFDGVTSMIYRHHGYVTFDSRDRFFD
EGVNGDALTYLTLANRLAHDFRPSAVTIAEDVSGMPGMCIPIADGGIGFDYRLGMAIPDF
WIKQLKEVPDEQWDIREMWSVMTDRLPEVKTVAYAESHDQALVGDKTIAFRLMDKEMYFH
MDRASENIVIDRGMALHKMIRLMTISTGGQAYLNFMGNEFGHPEWIDFPREGNGWSYAHA
RRQWSLAKNGFLRYAWLGDFDRAMIRLVKKYKVLADGYPWNLLMDERNKTMAFSHGDLLF
VFNWHPSASIPDYELPVQAPGKYVPVLSTDESRFGGQERQSMAAEHFSFDAGEGDGQRQP
HIRIYNTSRTATVYLRKK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacgacccgaagacttccgatcgtcgaacgcgacgaatggttacagcccgtc
gaggcgcagatgaacctgcgccacgagcgttacgagcggaaaatggccgacatcggacgc
tcggcgggatcgctcgtcgactacgccaacggctaccgctatttcggctggcagtgggac
gatgtgctggacggctggtggctgcgcgagtggctgccgggggcgcacgacgtctacgtc
ttcggcgacttcaacaactggcagcgcaccgaaatccgcatgcacaaggatgccgcgggg
gtctggagcgcctttttccccgcggcgatgtaccgcgaccggctgcggcacggctcgctc
tacaagatccacgtccacggcgacaacggctggctggaccgcattccggcctacgcccgg
cgcgtcgtgcaggacgacgagaccaaaaactacacggcgcagttctggaaccccgcggaa
ccgttcgactggcggggcgacgcgttcgacgcctcgaagatcggcagcctgctgatctac
gaagcccatgtgggcatggcccaggagcgcgagggcgtgggaacctaccgcgaattcacc
gaaaagatactcccgatcatcaaaaaggacggctacaacgccgtgcagctgatggccgtg
gccgagcacccctactacgggtcgttcggttaccacgtgtcgagtttcttcgccccctcg
tcgcgctgcggcacgcccgaggagctgaaggagctgatccgccgcgcccatgaactgggg
ctggcggtgatcatggacctcgtgcacgcccactacgtcaagaacctcaacgaggggatc
aactccctcgacggcaccgaccatctctactcgccgccgggcgacgcgggctaccagcag
tactgggattcgaaactcttcgactacggcaaggaggaggtgcagcacttcctgctgtcg
aacgtcaaatactggctcgacgagttccatttcgacggctaccgcttcgacggcgtgacg
tcgatgatctaccgccaccacggctacgtcacgttcgattcgcgcgaccgtttcttcgac
gagggggtcaacggggacgctctcacctacctcaccctggccaaccgcctcgcgcacgat
ttccggccttcggccgtgaccatcgccgaggacgtgagcggcatgccggggatgtgcatc
ccgatcgccgacggcggcatcggattcgactaccgcctgggcatggccatccccgacttc
tggatcaagcagctgaaggaggtgcccgacgagcagtgggacatccgggagatgtggtcg
gtgatgaccgaccgcctgcccgaagtcaagaccgtggcctacgccgagtcgcacgaccag
gcgctcgtcggcgacaagaccatcgccttccggctgatggacaaggagatgtatttccac
atggaccgcgcttcggagaacatcgtcatcgaccgcggcatggccctgcacaagatgatc
cgcctgatgaccatctccacgggcggtcaggcctacctcaacttcatgggcaacgagttc
gggcatcccgagtggatcgacttcccgcgcgagggcaacggctggagctacgcccacgcc
cggcggcagtggtcgctcgcaaaaaacggattcctgcgctatgcgtggctgggcgatttc
gaccgcgcgatgatccggctggtgaaaaaatacaaggttcttgccgacggttacccgtgg
aatctgctgatggacgagcgcaacaagacgatggccttctcgcacggcgacctgctgttc
gtcttcaactggcatccttcggcctcgatccccgactacgaacttccggtgcaggccccg
ggcaagtacgtcccggtgctctcgaccgacgaaagccgcttcggcggacaggagcggcag
tcgatggcggccgaacacttctcgttcgacgccggggagggcgacggacagcggcagccc
catatccgcatctacaacacctcgcgcacggcgacggtctacctgcgaaaaaagtag

DBGET integrated database retrieval system