KEGG   Alistipes shahii: AL1_02150Help
Entry
AL1_02150         CDS       T02578                                 

Definition
O-Glycosyl hydrolase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ash  Alistipes shahii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AL1_02150
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AL1_02150
Enzymes [BR:ash01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AL1_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249980..251494
Genome map
AA seq 504 aa AA seqDB search
MKFTINNNLRLLTCPLLLAGAVCCSSGNDGDTPAPGPGPDPSPVTGDVLAYVTSADGNRL
FTEEGLDYSKVSMSPYRVTIDPSTTYQTVDGFGPAITGATCYNLLQMSQADRTAILRKCF
DPETGAGFSFIRVHIGGSDFSMDEYTCCDREGIEFFAIPAVEKDGIFPVLKEILEINPEI
RIMGSPWSCPKWMKGTVADPSKPYDSWTGGRLNPAYYDDYAEYFVQWVTEMEENGFPIYA
ITMQNEPLNKGNSMSLYMPWEDQLAFVKKLGPAFRKAGIDTKILCYDHNYNYDNVAGQQN
YPLNIYADADAAQWVDGSAWHNYGGSVSELDNIRAAAPDKTIYFTEASIGTWNYNFESCV
IDDFESIFLGTLSRYGKGVLLWNLMLDDKGAPNRPGGCTTCYGAIEISSSDYKTLKYNSH
YYDLAQCAKVIRPGAVRIGASGYTASGLTYLAFRNPDGSKAFVALNRSAGEQTVAVYENA
DRSFKYTIPAKSIASFRWGAGAEN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacgatcaataacaacctgcgcctgctgacctgcccgctgctgctcgccgga
gccgtatgctgttccagcgggaacgatggcgacacgccggctcccggtcctggccccgat
ccctcgcccgtgacgggcgatgttctcgcctacgtcacctcggccgacggcaaccgcctg
ttcacggaggagggactcgactactcgaaggtctcgatgtcgccctaccgggtcacgatc
gacccctcgacgacctaccagaccgtcgacggtttcggcccggccatcaccggcgccacg
tgctacaacctgctgcaaatgtcgcaggccgaccgcacggcgatcctccggaagtgcttc
gaccccgagaccggagccggtttcagctttatccgcgtgcatatcggcggctcggacttc
tcgatggacgaatacacctgctgcgaccgggagggcatcgaattcttcgccattcccgcc
gtggagaaggatggcatctttccggtgctgaaagagattctggagatcaatcccgaaatc
aggatcatgggttcgccgtggtcgtgccccaaatggatgaagggcacggtcgccgacccc
tcgaaaccctacgattcgtggaccggcgggcgtctcaatcccgcctattacgacgattac
gccgagtatttcgtgcagtgggtgaccgagatggaggagaacggattcccgatctacgcc
atcacgatgcagaacgagccgctgaacaagggcaattcgatgtcgctctacatgccgtgg
gaggaccagctggccttcgtcaagaaactcggcccggcattccgcaaggcgggcatcgac
accaagatcctctgctacgaccacaactacaactacgataacgtcgccggccagcagaac
tacccgctcaacatctacgccgacgccgatgctgcgcagtgggtcgatggctcggcctgg
cacaactacgggggcagcgtgagcgagctggacaacatccgcgccgccgcgcccgacaag
acgatctacttcaccgaggcttcgatcggcacgtggaactacaatttcgagagctgcgtg
atcgacgacttcgagtcgatcttcctggggacgctgagccgctacggcaaaggggttctg
ctgtggaacctgatgctcgacgacaagggcgctccgaaccgtcccggaggctgtacgacc
tgctacggggccatcgagatcagttcgtcggattacaagacgctcaagtacaacagccac
tattacgacctggcccagtgcgccaaggtcatccggccgggtgccgtgcgcatcggcgcg
tcgggttacacggcgtcggggctgacctacctggccttccggaatcccgacggatcgaaa
gccttcgtggcgctcaacaggagcgccggcgaacagaccgtcgccgtgtatgaaaacgcc
gaccgttcgttcaaatacaccatcccggccaagtcgatcgcctcgttccgctggggcgcc
ggagccgaaaactaa

DBGET integrated database retrieval system