KEGG   Alistipes shahii: AL1_02810Help
Entry
AL1_02810         CDS       T02578                                 

Definition
Pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ash  Alistipes shahii
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AL1_02810
   00500 Starch and sucrose metabolism
    AL1_02810
Enzymes [BR:ash01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AL1_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329192..330172
Genome map
AA seq 326 aa AA seqDB search
MMKSAVIITILLLSSFVASAEKVYTVDCNGGGDFRTIQACFDALPSKPAEWRTVRIMPGV
YREKVTLDVYKDKVRILGDEMAETRIVWGDYAGKVVDGRELTTYDSYTMSVQADDVYLDC
LTVENDAGRVGQAVALETRGDRIHLYHCALIGDQDTFFARGYVSRVHVENCYIEGTTDFI
FGPSIVLFECSTIHCKADSFITAASTTERNEYGFVFSCCRVTAAEGVTRVYLGRPWKSTA
RTVWLECEFPAAIRPEGWRDWHDAARKGDVYYAEWRCEGPGADRSGRVAWSRELTDAEAD
VYDNRCIFAKKTGSEQFRDDWDGFAE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatccgctgtaatcataacgatccttctcctttcctcgttcgtcgcctcggca
gagaaggtctataccgtcgactgcaacggcggcggggatttccggaccattcaggcgtgt
ttcgacgccctgccgtcgaagcctgcggagtggcgcacggtgcggattatgcccggcgtc
tatcgcgagaaggtgacgctcgacgtctataaggacaaggtccggattctgggcgatgaa
atggctgaaacccgcatcgtctggggcgactatgccggcaaagtcgtcgacggccgcgag
ctgaccacctacgacagctatacgatgtccgttcaggccgacgatgtctatctggattgc
ctgaccgtcgagaacgatgccggaagggtagggcaggctgtggcgctcgaaacccgcggt
gaccgcatccatctgtatcattgtgcgctcatcggcgatcaggacaccttctttgctcgc
ggctacgtttcgcgcgtacatgtcgagaattgttatatcgagggaaccaccgacttcatt
ttcggcccttcgatcgtgctgttcgagtgttcgacgatccattgcaaggccgacagtttc
atcacggccgcttcgaccaccgagcgcaacgaatacggattcgtcttctcctgctgccgt
gtgacggcggccgaaggggtgacgcgggtttacctcgggcgtccgtggaaatcgacggcc
cgcaccgtgtggctggagtgcgaatttcccgcggcgatccgtcccgaggggtggcgcgac
tggcacgacgcggcccgtaaaggcgatgtgtactatgccgaatggcgttgcgaaggaccc
ggcgccgaccgttcgggccgcgtggcgtggtcgcgggagctgaccgatgccgaggccgac
gtttacgacaaccggtgcatttttgccaaaaagaccggctccgagcagttccgcgacgac
tgggatggcttcgcggaatag

DBGET integrated database retrieval system