KEGG   Alistipes shahii: AL1_04480Help
Entry
AL1_04480         CDS       T02578                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ash  Alistipes shahii
Pathway
ash00521  Streptomycin biosynthesis
ash00523  Polyketide sugar unit biosynthesis
ash01130  Biosynthesis of antibiotics
Module
ash_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AL1_04480
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AL1_04480
Enzymes [BR:ash01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AL1_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CBK63095
UniProt: D4IJI3
Position
complement(503323..503886)
Genome map
AA seq 187 aa AA seqDB search
MKAIKTEIPGVVLLEPEVFGDARGYFMERFSQRRFDELVGPVRFVQDNESKSRYGVVRGL
HFQKGEYAQAKLVSVVRGRVLDVAVDIRRGSPTFGRHVAALLDGENKRQLFIPRGFAHGF
AVLSDEAVFQYKCDNYYAPGSEGGIAWDDPALAIDWRLPAGEILLSEKDRRHPKLADAPE
LFEYDRP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgataaaaacggagatccccggcgtggtgcttctcgaaccggaggtgttcggg
gacgcaaggggttattttatggagcgtttctcgcagcggcggttcgacgaactggtcggg
ccggtgcggttcgtgcaggacaacgagtcgaaatcgcgctacggagtggtccggggcctg
catttccagaagggggaatacgcccaggcgaagctggtgagcgtggtcaggggccgcgtg
ctcgacgtggcggtggacatccgccgcggatcgccgaccttcggacggcacgtcgccgcg
ctgctcgacggagagaacaagcggcagttgttcatcccccgcggattcgcccacggattc
gccgtgttgagcgacgaggccgtcttccaatacaaatgcgacaactactacgcccccggc
agcgagggcggcatcgcgtgggacgaccccgcgctcgcgatcgactggcggcttccggcc
ggcgaaatactcctctcggagaaagaccgccggcacccgaagctggccgacgcaccggaa
cttttcgaatacgacagaccatga

DBGET integrated database retrieval system