KEGG   Alistipes shahii: AL1_14140Help
Entry
AL1_14140         CDS       T02578                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ash  Alistipes shahii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AL1_14140
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AL1_14140
Enzymes [BR:ash01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AL1_14140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1615810..1616904)
Genome map
AA seq 364 aa AA seqDB search
MNCESKKYRRIVVKIGSNVLTREDGRPDTTRISALVDQLARLHRAGTEFILVSSGAVASG
RSLLETRVGRIDTVSARQLFSAVGQVKLLNRYYDLFNEYGIACGQVLTTKESLSTRRQYL
NQRNCMEAMLAAGVVPIVNENDTISVTELMFTDNDELSGLVAAMMGAEALVILSNIDGIY
DGSPSDPASQVIRRVAPGRDLSQYIDTARSSRGRGGMTTKSRISSRAAGEGIEVVIANGR
RDNILTDLILTDRDVVCTRFEAAPRPASGVKKWIASSEGFAKGALHLDAGAAAAVSQSKA
ASILAVGVTAVEGDFERDDIVRILSPEGAPLGVGRISCDSATARRNLGRKGLKPLIHCDY
LYLE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtgaatcgaaaaaataccgccgcatcgtcgtcaagatcggcagcaatgtgctc
acccgcgaggacggacggcccgacaccacgcgcatctcggcgctcgtggaccagttggcg
cgcctgcaccgggccggcacggagttcatcctcgtctcgtcgggcgccgtggcctcgggc
cgcagcctgctcgaaacccgcgtcggacgcatcgacaccgtttcggcccgccagctcttc
tcggccgtcgggcaggtgaaactgctgaaccgctactacgacctcttcaacgaatacggc
atcgcctgcgggcaggtgctcaccaccaaggagagcctctccacgcggcggcagtacctc
aaccagcgcaactgcatggaggcgatgctcgcggcgggcgtcgtcccgatcgtcaacgag
aacgacacgatctcggtcacggagctgatgttcaccgacaacgacgaactttcgggtctc
gtggcggcgatgatgggagccgaggcgctcgtcatcttgagcaatatcgacggcatctac
gacggttcgccttcggaccccgcctcgcaggtcatccgccgcgtcgccccgggccgcgac
ctttcgcagtacatcgacacggcgcgttcctcgcgcggtcgcggaggcatgacgaccaag
agccgcatttcgtcgcgcgcggcgggcgagggcatcgaggtcgtgatcgccaacggccgc
cgcgacaatatcctgacggatctgatcctcacggaccgcgacgtcgtatgcacgcgtttc
gaagcggctccccgaccggcttcgggggtcaagaagtggatcgccagcagcgaaggcttc
gccaagggcgccctgcacctcgacgccggggccgccgcggccgtctcgcagagcaaggcc
gcgagcatcctcgccgtgggcgtcacggccgtcgaaggggatttcgagcgcgacgacatc
gtacgcatcctctcgcccgaaggcgccccactgggcgtgggccgcatctcgtgcgacagc
gcgacggcccgccgcaacctcggccgcaaaggtctcaaaccgctgattcactgcgattac
ctatatctggaataa

DBGET integrated database retrieval system