KEGG   Alistipes shahii: AL1_16560Help
Entry
AL1_16560         CDS       T02578                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ash  Alistipes shahii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ash00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ash00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ash00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1892791..1894989)
Genome map
AA seq 732 aa AA seqDB search
MKKLLIPLIAAFAANTVSAAAPQQVIDISTDKVSMVLTAAPGGEVYFRHFGGRIDDPAPL
ADYKSNRRSDHGTEDLAYPATGGRNFREPALRVTHADGDMNTELRYVSHASKQLSDKNVT
ETVVKMTDCCQALDVELVFTAYARENVITTHAVIRNREKGPVTLHSFYSSSLPLKADKYL
LTHLYGAWAREAQVDHTLLTHGSKSIESTREVRTTHTENPAFLLTLNSDSFSETCGEVIA
GALAWSGNFRLNFEVDEFDVLTVLAGANPNASEYRLRPGETFTTPEMIYTHSFCGAGGAS
RNLHDWARNYGVYHGHEVVPTLLNSWEGAYFKFDAKVLKQMIDDAASMGLEMFVLDDGWF
GNKYPRNNSNAGLGDWQVNAAKLPEGIDHIASYAHSKGLKFGIWIEPEMVNPKSELAEKH
PDWIVRPPKREAPTTRNQWLLDLTNPKVQDFVFGVFDNTMKLSDKIDYIKWDANRNANNV
GSAYLPADEQSRFWIDYAQGFYKVMERIRAKYPDVLIQACASGGGRVEYGALKYFDEVWM
SDNTEALSRARIQYGTSLFYPAVVMGSHVSATPNHQTGNITPIKFRFDMACAGRLGMELQ
PRQMTDEERQFARRAIASYKEYRDIVMQGDLYRIGTPYDKSGCYGLMYVSKDRKQAVLFT
YSLRYQGRSLIPKFRLQGLDPKTGYTIRELNVDKSRNWFDGKTFSGEMLSNAGINPSMPK
IYDSGVFLLTAE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactgatccccctgattgccgcctttgccgcgaacaccgtatcggccgcc
gcgccgcagcaggtcatcgacatcagcaccgacaaggtctcgatggtgctcaccgccgcc
cccggaggcgaagtttatttccgccacttcggcggacgcatcgacgacccggcgccgctg
gccgactacaagagcaaccgccgcagtgaccacggaaccgaggacctggcctatcccgcg
acgggaggccgcaacttccgcgaacccgccctgcgcgtcacccatgccgacggcgacatg
aacaccgaactgcgctacgtgtcgcacgcctcgaaacagctctccgacaagaacgtgacg
gagaccgtcgtgaagatgaccgactgctgccaggcgctcgacgtggaactggtcttcacg
gcctacgcccgcgaaaacgtcatcaccacgcacgccgtgatccgcaaccgcgagaagggt
cccgtcacgctgcacagcttctactcctcgtcgctcccgctgaaggccgacaaatacctc
ctgacgcacctctacggggcctgggcgcgtgaagcgcaggtcgaccacacgctgctgacc
cacggatcgaaaagcatcgagtcgacgcgcgaggtgcgcacgacccacaccgaaaacccg
gcgttcctgctcacgctgaacagcgattcgttcagcgagacctgcggcgaagtcatcgcc
ggagcgctggcctggagcggcaacttccgcctcaacttcgaggtcgacgaattcgacgtg
ctgaccgtcctggccggcgccaaccccaacgcctcggagtacaggctccgcccgggcgag
acgttcaccacgcccgaaatgatctacacccactcgttctgcggcgcgggcggcgcctcg
cgcaacctccacgactgggcgcgcaactacggcgtctaccacggccacgaggtcgtcccc
acgctgctcaacagctgggaaggcgcctacttcaagttcgacgccaaggtcctgaaacag
atgatcgacgacgcagcctcgatgggattggaaatgttcgtcctcgacgacggctggttc
ggcaacaaatacccgcgcaacaactccaacgccggactgggcgactggcaggtgaacgcc
gcgaaactccccgaaggcatcgaccacatcgcctcctacgcccactcgaagggactgaag
ttcggcatctggatcgaaccggagatggtcaaccccaagagcgagctggccgagaagcac
cccgactggatcgtccgtccgccgaagcgcgaagcgcccacgacccgcaaccagtggctg
ctcgacctcacgaaccccaaggtgcaggacttcgtgttcggagtcttcgacaacacgatg
aaactctcggacaagatcgactacatcaagtgggacgccaaccgcaacgccaacaacgtg
ggttcggcctacctcccggccgacgaacagtcgcgcttctggatcgactacgcgcagggc
ttctacaaggtgatggaacgcatccgcgccaaataccccgacgtgctgatccaggcctgc
gcctcgggcggcggccgcgtggagtacggcgccctgaagtatttcgacgaagtgtggatg
agcgacaacaccgaggcgctttcgcgcgcgcgcatccagtacggcacgagccttttctac
cccgccgtcgtgatgggttcgcacgtctcggccacgcccaaccaccagacgggcaacatc
acgcccatcaagttccgcttcgacatggcctgcgccggacgcctcggcatggagcttcag
cccaggcagatgaccgacgaggagcggcagttcgcccgccgggccatcgccagctacaag
gagtaccgcgacatcgtgatgcagggcgacctctaccgcatcggcacgccctatgacaag
agcggctgctacggcctgatgtacgtttcgaaggaccggaagcaggccgtgctgttcacg
tacagcctccggtaccagggccgctcgctgatcccgaaattccgcttgcagggcctcgac
ccgaagacgggctacaccatccgcgaactgaacgtcgacaaatcgcgcaactggttcgac
ggcaaaaccttcagcggcgagatgctctcgaacgccggcatcaacccctcgatgccgaag
atttacgacagcggcgtattcctgctcacggcggaatag

DBGET integrated database retrieval system