KEGG   Alistipes shahii: AL1_18330Help
Entry
AL1_18330         CDS       T02578                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ash  Alistipes shahii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ash00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ash00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2080937..2081371)
Genome map
AA seq 144 aa AA seqDB search
MIEGVILAPLKRISVTKGDIFYALKSSDAVYSGFGEAYFSEIHPKEIKGWKRHKRMTLNI
IPVNGAIGFVLYDNRPGSSTYGEFEHIVLSRNNNYQRLTVPPGLWMAFYCASNDTAMLMD
IIPEPHDPDEADRLDLSAIKYDFI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaggagttatacttgcgcctctgaagcgtatctccgtcacaaaaggtgatata
ttttatgcgcttaaatcctcagatgctgtgtatagcggttttggggaggcatacttctcc
gaaattcaccccaaagaaatcaaagggtggaaacgccacaagcgcatgacgttaaacata
ataccggtcaacggagcaattggttttgtgttgtatgataatcgtccaggcagttccact
tatggagagttcgagcatattgttttatctaggaacaacaattatcagcgtctgacggta
ccacccggactatggatggcattctactgcgcaagcaacgacactgcaatgttgatggat
ataattcctgagccacatgatcctgatgaagcagacagacttgatctttcggcaataaaa
tatgattttatatga

DBGET integrated database retrieval system