KEGG   Alistipes shahii: AL1_25580Help
Entry
AL1_25580         CDS       T02578                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ash  Alistipes shahii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AL1_25580
  Lipid metabolism
   00561 Glycerolipid metabolism
    AL1_25580
   00600 Sphingolipid metabolism
    AL1_25580
Enzymes [BR:ash01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AL1_25580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2919720..2921897)
Genome map
AA seq 725 aa AA seqDB search
MKKLLVLAWAGAALLSGGMLRAENILLSTRNSSLLLTAEKGKTPLFQYFGARVASPDDIL
ASGAAFGDAAYPQFGAQCYREVAIQATHGDGSMSLELAVESVSRDRRDGSETTAIAMKDK
HYPFFVTLFYKTYDDCEVIETWTEISHTEKKPVTLYRFASAYMPVRRGDTWLTHFHGTWG
AECYLHEEPLTDGMKVLKNKDGVRNTQRDNPSLMISLDGRPRELTGRVIGGTLAWAGNYR
IALDNDNTHTTHLFAGINEEQSQYTLQPREVFTTPVFAFTFSDEGKSGVSRNIHRWARLH
RLNHGTELRDVLLNSWEGVYFKVNQEGMDRMMADLADLGGELFVMDDGWFGDKYPRNNGE
TSLGDWTVCREKLPQGIEGLTESARKHGVKFGIWIEPEMTNTRSELYEKHPDWVIQQPYR
ENRKGRGGTQQVLDLSNPAVQEFVFSVVDRLMTAHPDIAYIKWDDNMTLYNYGSTFLPAD
RQSHLYIEYHRGMDKVLRRIQEKYPRLVMQSCASGGGRVNYGVLPYYDEFWTSDNTDALQ
RIYMQWGVSNFYPAVAMASHVSASPNHQTGRNVPLKLRFDVAMSGRLGLELQPSKMTGKE
KEFARRAIADYKKIRPIVQQGDLYRLISPYDKTGYASLMYVAPEKDRAVWFVYKLEHFLN
MPSPAFRMAGLDPGKRYRITELNVDGKPVPQDGKTFSGAFLMENGLEFTVGKEYASRVLE
LKAVE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttttggtattggcatgggccggcgctgcgttgctgtccggcggcatgctc
cgggcggaaaacatcctcctctcgacccggaattcctcgctgctgctgacggcagaaaaa
ggcaaaacccctctgttccagtatttcggagcgcgcgtcgcctcgcccgacgacatcctc
gccagcggagcggcgttcggcgatgcggcctacccgcagttcggcgcccagtgttaccgc
gaagtagccattcaggcgacgcacggcgacggttcgatgtcgctcgaactggctgtcgag
tcggtgtcgcgcgaccgcagggacggctccgaaaccaccgccatcgccatgaaggacaag
cactacccgtttttcgtgacgctcttctacaagacctacgacgactgcgaggtgatcgag
acgtggaccgagatcagccacacggagaagaaacccgtgacgctctaccggttcgcatcg
gcctacatgcccgtccgccggggcgacacgtggctgacgcatttccacggcacatgggga
gcggaatgctacctccacgaagaaccgctgaccgacggcatgaaggtgctcaagaacaag
gacggcgtgcgcaacacgcagcgcgacaacccctcgctgatgatctcgctcgacggacgc
ccccgggagttgacaggccgcgtcatcggcggcacgctggcctgggccggcaactaccgc
atcgccctggacaacgacaacacccacaccacgcacctcttcgcgggcatcaacgaggag
cagtcgcaatacacgctgcaaccccgcgaggtcttcacgaccccggtattcgccttcacg
ttcagcgacgagggcaagagcggcgtgagccgcaacatccaccgatgggcgcgcctccac
cggctcaaccacggaaccgagcttcgcgacgtgctgctcaactcgtgggagggcgtctat
ttcaaggtcaaccaggagggcatggaccggatgatggccgacctggcggacctgggcggc
gaactgttcgtgatggacgacggctggttcggcgacaaatacccgcgcaacaacggcgag
acgagcctcggagactggacggtctgccgcgagaaactgccgcagggcatcgagggactg
accgagtcggcccgcaaacacggcgtgaagttcggcatctggatcgaacccgagatgacc
aacacccggagcgaactctatgagaagcatcccgactgggtgatccagcagccctaccgc
gaaaaccgcaagggccgcggcggcacgcagcaggtgctcgatctgtcgaaccccgcggtg
caggagttcgtcttcagcgtggtcgaccgtctgatgaccgcgcatcccgacatcgcctac
atcaagtgggacgacaacatgacgctctacaactacggctcgaccttcctgccggccgac
cggcaatcgcacctctacatcgagtaccaccgcggcatggacaaggtgctgcggcgcatc
caggagaaatatccccgtctggtgatgcagtcgtgcgccagcggcggcggccgggtcaac
tatggcgtcctgccctactacgatgaattctggacctcggacaacaccgacgccctgcaa
cgcatctacatgcaatggggcgtgtcgaacttctatcccgccgtggcgatggcctcgcac
gtgagcgcctcgcccaaccaccagacgggccgcaacgttccgctcaaactgcgcttcgac
gtggccatgtcgggacgcctggggctggagctgcaaccctcaaagatgaccggcaaagag
aaggagttcgcccgcagggcgatcgccgactacaagaagatccgccccatcgtgcagcag
ggcgacctctaccggctgatctcgccctacgacaagacaggctatgcatcgctgatgtac
gtcgcacccgaaaaggaccgcgccgtctggttcgtctacaagctggagcacttcctcaac
atgccgtcgccggccttccgcatggcgggtctcgaccccggcaaacgctaccggatcacc
gaactgaacgtcgacgggaagccggtcccgcaggacggcaagaccttcagcggcgcgttc
ctgatggagaacggactcgaattcacggtgggcaaggaatatgcgagccgcgtactcgaa
ctcaaagcggtggagtaa

DBGET integrated database retrieval system