KEGG   Alistipes shahii: AL1_27440Help
Entry
AL1_27440         CDS       T02578                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ash  Alistipes shahii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AL1_27440
Enzymes [BR:ash01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AL1_27440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3161462..3162037
Genome map
AA seq 191 aa AA seqDB search
MFLENASRKGWIEVVCGSMFSGKTEELIRRLKRAKFAHQRVEIFKPRIDVRYSEEEVVSH
DANAIRSTPVESPQNILLMTADVDVVGIDEAQFFDESIVDVCRRLANNGVRVIVAGLDMD
YTGKPFGPMPALMATAEYVTKVHAICVRCGNLAHHSHRLTSDEKQVMLGAQDSYEPICRH
CFNKLMNGEKA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatgccagccgcaagggctggatcgaagtcgtatgcggttcgatgttc
tcgggtaagaccgaggagctgatccgccgcctgaaacgagccaaattcgcccaccagcgg
gtcgagattttcaaaccccggatcgacgtgcgctattccgaggaggaggtcgtgtcgcac
gacgcgaacgccatccgctccacccccgtcgagtcgccgcagaacatcctgctgatgacc
gccgacgtcgacgtggtgggcatcgacgaggcgcagttcttcgacgaaagcatcgtcgac
gtgtgccgccggctggccaacaacggcgtgcgcgtgatcgtcgcgggtctggacatggac
tacaccggaaagccgttcggcccgatgcccgcgctgatggcaacggcggagtacgtcacc
aaggttcacgccatctgcgtccgctgcggcaacctcgcccaccattcgcaccgcctcacg
agcgacgaaaagcaggtgatgctgggcgcgcaggacagctacgaaccgatctgccgccat
tgcttcaacaagctgatgaacggagagaaagcgtag

DBGET integrated database retrieval system