KEGG   Actinobacillus suis: ASU2_01305Help
Entry
ASU2_01305        CDS       T02262                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asi  Actinobacillus suis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ASU2_01305
Enzymes [BR:asi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ASU2_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281742..283682
Genome map
AA seq 646 aa AA seqDB search
MLTLLETLKAENHLSELNYQFAKMIAHKQQAYNYNESQQNLAILLAALLSFHVMQGHTAL
RLDSNAAQSFFGLEHKKLERDFQVEILQKIGGISPLEWQDILHDHIAFSHSPMQVAPMLF
QHGLLYFYRYWQAEHNIARYLQQAVEFPEEFANTDLDKQILSELFPEKTTEIDWQKIAVA
TALRQRFCVISGGPGTGKTTTVAKLLVALQTRQYRQQKSALNIALVAPTGKAAARLKESI
SNSFEKMQLTFEIPTYASTIHRLLGVRPNSDTPTYHAINPLHLDLLVVDEASMIDLSLME
KLMNALKPSTRLIILGDKDQLASVEAGAIMGELGEFVQLGYSSAHCDYLYKVTGYSLSEQ
ASVLPICDTLCHLQKSHRFSEHSGIGQLAALVNQQKENESWRIFTKFQTDLVCIKYPSTT
QFTEKRQWIQHCVNLVVEKAVEHYQVYLKLVQQRMGNPDKVSVNEIFEAFQKVRFLSALR
VSELGSERLNQSIAEALRKACLLNFTFSRDSYAGKPILITQNSPENNIYSGDIGIILPDE
HNQLRVYFDTKVENTHLSLSLSRLPEHEVAYVMTVHKSQGSEFEHTFFIMPLNSAPVITK
ELIYTAVTRAKQTFTLFSEEKVWKIGVRANVQRQSGLREQLKNMFS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttaacactcctcgaaacgcttaaagcggaaaatcatctctctgaattaaattatcaa
tttgccaaaatgattgcgcataagcagcaggcatacaattataatgaatcgcaacaaaac
ctcgctattctattagctgcattactttcatttcatgttatgcaaggacataccgcgtta
cgactcgattcaaatgcggcgcaatctttttttggcttggaacataaaaaattagaacgt
gattttcaggttgagattttgcaaaaaataggcggaatctcaccgcttgaatggcaagat
atattgcatgatcatattgcatttagccattctccgatgcaagtcgccccaatgctattt
cagcatggtttactttatttttaccgttattggcaggcggaacataacatcgcccggtat
ttacaacaagcggtcgaatttccggaagaatttgcaaatactgatttggacaaacaaatt
ctttctgagcttttcccagaaaaaacaacggaaattgattggcaaaagattgcggttgcc
accgcattgcgtcaacgtttttgtgtgatttccggtggtccgggaacaggaaagacaacg
acagttgctaaattattagttgccttacaaacccgacaatatcgtcagcagaaatctgca
cttaatattgcgctggtcgctccaaccggtaaagcggcggcacgcttgaaagaatcaatt
agtaatagctttgaaaagatgcaacttacatttgagattcctacgtatgcctcaacgatt
catcgtttactcggtgtgcgtcccaattcagatacaccgacataccatgcgataaatccg
ttacatcttgatttattagtcgtggatgaggcatcaatgatcgatttatcattaatggaa
aaattaatgaatgcattgaagccgagtacacgtttgatcatcttaggtgataaagatcag
ctcgcttcagtagaagctggtgcaataatgggagaacttggtgagtttgtgcaactaggg
tatagctcggcacattgcgattatttatataaagtgacaggctattcgttgagtgaacaa
gcaagcgtattacctatttgtgatacgctttgccatttacaaaaaagtcatcgctttagt
gagcattctggtatcgggcaattggctgcattagtgaatcagcagaaagagaatgagtcg
tggcggatttttactaaattccaaacggatttagtttgtatcaaatatcctagtactact
caatttactgaaaagcgccaatggattcagcactgtgtcaatttagtggttgagaaagcg
gtagagcactatcaggtatatctaaaattggtacagcaacgtatgggcaatccggataaa
gtctcagtaaatgaaatttttgaagcgtttcagaaagtgagatttttatctgctttgcgt
gtgagtgaattaggcagtgagcgtttaaatcagagcattgcggaagcattaagaaaagcc
tgtctacttaatttcacttttagtcgtgacagttatgcgggaaaaccgattttaattacg
caaaattcgcctgaaaataatatctatagtggcgatatcggcatcattttacctgatgaa
cataatcagctaagagtttattttgatacgaaagtagaaaatacccacttaagtttgtcg
cttagtcgtttacctgagcatgaagtcgcttatgtaatgacggttcataaatcacaaggt
tctgagtttgaacatactttctttattatgccgttaaacagtgcaccggttattacaaaa
gaactgatttatacggcagtcactcgagcgaaacagacatttactttatttagtgaagaa
aaagtctggaagataggagtaagagcaaatgtacaacgccaaagtggcttgcgagagcaa
ttaaaaaacatgtttagctaa

DBGET integrated database retrieval system