KEGG   Actinobacillus suis H91-0380: ASU2_01305Help
Entry
ASU2_01305        CDS       T02262                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ASU2_01305
Enzymes [BR:asi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ASU2_01305
DNA repair and recombination proteins [BR:asi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ASU2_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 DUF2075 UvrD-helicase AAA_22 PIF1 DEAD CbiA NACHT UvrD_C ResIII AAA_16 AAA_28 TrwB_AAD_bind T2SSE NTPase_1 SRP54 AAA Zeta_toxin AAA_29
Motif
Other DBs
NCBI-ProteinID: AFU18403
UniProt: K0G2M2
Position
281742..283682
Genome map
AA seq 646 aa AA seqDB search
MLTLLETLKAENHLSELNYQFAKMIAHKQQAYNYNESQQNLAILLAALLSFHVMQGHTAL
RLDSNAAQSFFGLEHKKLERDFQVEILQKIGGISPLEWQDILHDHIAFSHSPMQVAPMLF
QHGLLYFYRYWQAEHNIARYLQQAVEFPEEFANTDLDKQILSELFPEKTTEIDWQKIAVA
TALRQRFCVISGGPGTGKTTTVAKLLVALQTRQYRQQKSALNIALVAPTGKAAARLKESI
SNSFEKMQLTFEIPTYASTIHRLLGVRPNSDTPTYHAINPLHLDLLVVDEASMIDLSLME
KLMNALKPSTRLIILGDKDQLASVEAGAIMGELGEFVQLGYSSAHCDYLYKVTGYSLSEQ
ASVLPICDTLCHLQKSHRFSEHSGIGQLAALVNQQKENESWRIFTKFQTDLVCIKYPSTT
QFTEKRQWIQHCVNLVVEKAVEHYQVYLKLVQQRMGNPDKVSVNEIFEAFQKVRFLSALR
VSELGSERLNQSIAEALRKACLLNFTFSRDSYAGKPILITQNSPENNIYSGDIGIILPDE
HNQLRVYFDTKVENTHLSLSLSRLPEHEVAYVMTVHKSQGSEFEHTFFIMPLNSAPVITK
ELIYTAVTRAKQTFTLFSEEKVWKIGVRANVQRQSGLREQLKNMFS
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttaacactcctcgaaacgcttaaagcggaaaatcatctctctgaattaaattatcaa
tttgccaaaatgattgcgcataagcagcaggcatacaattataatgaatcgcaacaaaac
ctcgctattctattagctgcattactttcatttcatgttatgcaaggacataccgcgtta
cgactcgattcaaatgcggcgcaatctttttttggcttggaacataaaaaattagaacgt
gattttcaggttgagattttgcaaaaaataggcggaatctcaccgcttgaatggcaagat
atattgcatgatcatattgcatttagccattctccgatgcaagtcgccccaatgctattt
cagcatggtttactttatttttaccgttattggcaggcggaacataacatcgcccggtat
ttacaacaagcggtcgaatttccggaagaatttgcaaatactgatttggacaaacaaatt
ctttctgagcttttcccagaaaaaacaacggaaattgattggcaaaagattgcggttgcc
accgcattgcgtcaacgtttttgtgtgatttccggtggtccgggaacaggaaagacaacg
acagttgctaaattattagttgccttacaaacccgacaatatcgtcagcagaaatctgca
cttaatattgcgctggtcgctccaaccggtaaagcggcggcacgcttgaaagaatcaatt
agtaatagctttgaaaagatgcaacttacatttgagattcctacgtatgcctcaacgatt
catcgtttactcggtgtgcgtcccaattcagatacaccgacataccatgcgataaatccg
ttacatcttgatttattagtcgtggatgaggcatcaatgatcgatttatcattaatggaa
aaattaatgaatgcattgaagccgagtacacgtttgatcatcttaggtgataaagatcag
ctcgcttcagtagaagctggtgcaataatgggagaacttggtgagtttgtgcaactaggg
tatagctcggcacattgcgattatttatataaagtgacaggctattcgttgagtgaacaa
gcaagcgtattacctatttgtgatacgctttgccatttacaaaaaagtcatcgctttagt
gagcattctggtatcgggcaattggctgcattagtgaatcagcagaaagagaatgagtcg
tggcggatttttactaaattccaaacggatttagtttgtatcaaatatcctagtactact
caatttactgaaaagcgccaatggattcagcactgtgtcaatttagtggttgagaaagcg
gtagagcactatcaggtatatctaaaattggtacagcaacgtatgggcaatccggataaa
gtctcagtaaatgaaatttttgaagcgtttcagaaagtgagatttttatctgctttgcgt
gtgagtgaattaggcagtgagcgtttaaatcagagcattgcggaagcattaagaaaagcc
tgtctacttaatttcacttttagtcgtgacagttatgcgggaaaaccgattttaattacg
caaaattcgcctgaaaataatatctatagtggcgatatcggcatcattttacctgatgaa
cataatcagctaagagtttattttgatacgaaagtagaaaatacccacttaagtttgtcg
cttagtcgtttacctgagcatgaagtcgcttatgtaatgacggttcataaatcacaaggt
tctgagtttgaacatactttctttattatgccgttaaacagtgcaccggttattacaaaa
gaactgatttatacggcagtcactcgagcgaaacagacatttactttatttagtgaagaa
aaagtctggaagataggagtaagagcaaatgtacaacgccaaagtggcttgcgagagcaa
ttaaaaaacatgtttagctaa

DBGET integrated database retrieval system