KEGG   Actinobacillus suis H91-0380: ASU2_01515Help
Entry
ASU2_01515        CDS       T02262                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00010  Glycolysis / Gluconeogenesis
asi00071  Fatty acid degradation
asi00350  Tyrosine metabolism
asi00620  Pyruvate metabolism
asi00625  Chloroalkane and chloroalkene degradation
asi00626  Naphthalene degradation
asi00650  Butanoate metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01130  Biosynthesis of antibiotics
asi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_01515
   00620 Pyruvate metabolism
    ASU2_01515
   00650 Butanoate metabolism
    ASU2_01515
  Lipid metabolism
   00071 Fatty acid degradation
    ASU2_01515
  Amino acid metabolism
   00350 Tyrosine metabolism
    ASU2_01515
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASU2_01515
   00626 Naphthalene degradation
    ASU2_01515
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ASU2_01515
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ASU2_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFU18445
UniProt: K0G9T7
Position
complement(333099..335714)
Genome map
AA seq 871 aa AA seqDB search
MANNAKNAQPYDAQAEVNVLVEKGLKALDEFRQLNQEQVDYIVAKASVAALDKHGILAMH
AYEETGRGVFEDKATKNLFACEYVVNNMRHLKTAGVISEDDVTGITEIADPVGVVCGITP
TTNPTSTTIFKALIAIKTRNPIVFAFHPSAQKSSAHAAQIVRDAAVAAGAPENCVQWIET
PSMEGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKTAKLEQAVY
DIVMSKSFDNGMICASEQAAIVDKEIYADFVKEMQSYGVYLVNKKEKALLEKFIFGVDKA
KDENCAGAKLNAAVVGKPAAWIAEQAGFSVPPKTNILLAECAFVGEGEPLTREKLSPVLA
LLKSNSTEHGLELSEAMVNFHGLGHSAAIHTQNAELARTFGERVKAIRVIWNSPSTFGGI
GDVYNSFLPSLTLGCGSYGKNSVSNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDS
IQYLKSMKNAEKVMIVTDRSMVDLGFVDRITDQLRQRRNKVMIQLFTDVEPNPSLQTVQR
GTELMRSFQPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLG
RKAKFVGIPTTSGTGSEVTPFAVITDGDIKYPLADYSLTPTVAIVDPALVMSVPAHVAAD
TGLDVLTHATEAYTSILANDYTDGLALQAIKLVFENLEKSVKEFDEVAREKMHNASTMAG
MAFANAFLGICHSMAHKIGGKFHTIHGRTNAILLPHVIRYNGTRPTKVATWPKYTNYVAD
KRFQDIARILGLPAATPEEAVESYAKAVHDLAVRCGVKMSLREQGIDEQEFLAARRELAL
NAFEDQCTPANPRLAMVEDMEELMTKAYYGK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatgcaaaaaatgcacaaccatatgacgctcaagcagaagtaaatgtactt
gttgaaaaaggtttaaaagcattagacgaattccgtcagcttaaccaagaacaagtggat
tatatcgtagcgaaagcctctgtggcggcactggataaacatggcatactcgcaatgcat
gcttatgaagaaacaggtcgaggtgtatttgaggataaagcaactaaaaacttatttgcc
tgtgaatatgtcgtcaataatatgcgtcatttaaaaacagccggcgtaattagtgaagat
gatgtaaccggtattaccgaaattgctgatcctgtcggtgttgtatgtggtatcacgcca
acaactaacccaacctcaacaaccattttcaaagcgttaatcgctattaaaactcgtaac
ccaatcgtttttgctttccacccttctgcacaaaaatcttcagctcatgcagcgcaaatt
gttcgtgatgcagcagttgctgccggcgcaccggaaaattgcgtacaatggattgaaacc
ccgtcaatggaaggtacttcagcattaatgaaacaccctggcatcgcaaccattcttgca
acaggtggtaatgctatggttgaagcggcatattcttgcggtaaaccagcattaggcgta
ggggcaggtaacgtaccggcttatgttgaaaaaacagcaaaattagaacaagccgtttat
gacattgtaatgtcaaaatcttttgacaacggtatgatttgtgcatctgaacaagcagca
attgtcgataaagaaatttatgccgatttcgttaaagaaatgcaatcttacggcgtatat
ctcgtaaataaaaaagaaaaagcactattagaaaaattcattttcggtgtggataaagca
aaagatgaaaactgtgccggtgcaaaactaaatgcggcggtagtaggtaaaccggctgca
tggattgccgaacaagcaggcttcagcgtgccaccaaaaacgaatatcctacttgcagaa
tgcgcttttgttggagaaggtgagccgcttactcgtgaaaaattatcaccagtacttgca
ttattaaaatcaaactcaaccgaacatggtttagagctttctgaagcgatggtgaatttc
catggtttagggcactcagcggcaattcacacacaaaatgccgaattagctagaacattc
ggtgaacgtgttaaagcaattcgtgtgatttggaactcaccgtcaacattcggtggtatc
ggcgatgtatataactcattcctaccgtccctcacattaggttgtggctcttacggtaaa
aactctgtaagtaacaacgtaagtgcagtgaacttaattaatattaaacgtgtgggcaga
cggagaaacaatatgcaatggtttaaagttccatcaaaaatctactttgagcgcgattca
atccaatatctcaaatcaatgaaaaatgctgaaaaagtgatgatcgtcaccgaccgctca
atggtagatcttggctttgtagatagaattactgatcagttacgtcaacgtcgtaataaa
gtgatgattcagctatttaccgatgttgaaccaaacccaagtttacaaaccgtacaacgt
ggtacagagctaatgcgcagcttccaaccggatactattattgcattaggtggcggttca
ccaatggatgcggcaaaagtaatgtggttattctatgaacaaccggaagtggatttccgt
gatttagtccaaaaatttatggatatccgtaaacgtgcgttcaaattcccacaattaggt
cgtaaagcaaaatttgtcggtattccaaccacatctggtacaggttctgaagtaacaccg
tttgcagtaattactgacggcgatattaaatatcctttagcagactactcattaacccca
accgttgcaattgttgaccctgcattagtaatgtcagtaccggctcacgttgcagcagat
acaggtttagacgtattaactcacgcaacagaagcttatacttcaattcttgccaacgac
tacaccgacggtttagcgttacaagcaattaaactggtatttgaaaacttagaaaaatcc
gtgaaagaatttgatgaagtcgctcgtgaaaaaatgcacaacgcctcaaccatggcaggt
atggcatttgcgaatgcattcttaggtatttgtcactcaatggcgcacaaaatcggtggt
aaattccacacgattcatggtcgtaccaatgcgattttattgccacacgtgattcgttat
aacggtactcgcccaacgaaagtggcaacttggccgaaatacacaaactatgttgcggat
aaacgcttccaagacattgcacgtattttaggtttaccagcagcaactccggaagaagcg
gtggaatcctatgcaaaagccgtacacgacttagcggtacgttgtggcgtgaaaatgtct
ttacgtgagcaaggtattgatgaacaagagttcttagcagcacgtcgtgagcttgcatta
aatgcctttgaagaccaatgtactccagcaaacccacgtcttgcaatggtagaagatatg
gaagagctaatgactaaagcttactacggtaaataa

DBGET integrated database retrieval system