KEGG   Actinobacillus suis H91-0380: ASU2_01525Help
Entry
ASU2_01525        CDS       T02262                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00860  Porphyrin and chlorophyll metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
Module
asi_M00121  Heme biosynthesis, glutamate => heme
asi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASU2_01525
Enzymes [BR:asi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ASU2_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 dCache_2 Endonuc-BglII
Motif
Other DBs
NCBI-ProteinID: AFU18447
UniProt: K0FVN6
Position
336913..337677
Genome map
AA seq 254 aa AA seqDB search
MNVLITRPDHRGQELVEMLNQHQIFAIHQPLFTIEAGTELPQLPSVMARLNTGDYVFAVS
KQAIDFASETLEQTGFHYRSDLNYFAVGQQSAQYFSSRSEQPVRYPIISENSEGLLLLDE
MQDLNGKNLLILRAETGRDLLAETAVSRGADVQYLECYRRKYVEENVAEKISLCKRVGVD
TIVVTSGDILTTLYEQTAEEDRVWLSECRLIVVSQRIAKMAYKLGWEQNNVILSEKADNN
SLLETVLNVIEKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttaattactcgccccgatcatcgagggcaggaattagttgagatgctgaat
cagcatcaaatttttgcgattcatcagccgctatttacaattgaagcagggacagaactt
cctcagttgccttcagttatggctcggttaaatactggtgattatgtatttgccgtttct
aaacaagcaattgatttcgcttcggaaacgttggaacaaacaggttttcattatcgttct
gacttaaattattttgcggtaggtcagcaatcggcacagtatttttcatctcgtagcgaa
cagccagtgcgttatccgattatttcggaaaatagtgaggggttgttgttattagatgaa
atgcaagatctcaatggtaagaatttattgatactacgagcggaaactgggcgtgattta
ctggcggaaaccgcagtttctcgaggtgcggacgttcaatatttggaatgttatcgcaga
aaatatgtcgaagaaaacgttgctgaaaaaatcagcttgtgtaaacgtgtcggtgtcgat
acgatagttgtcacaagtggggatattttaacaactttatatgagcaaacagcagaagaa
gaccgcgtatggttatcagaatgccgtttaattgttgttagtcaacgcattgcaaaaatg
gcatataaattgggatgggagcagaataacgtgattctctctgaaaaagcagacaataac
agtttgctggaaaccgtattgaatgtgatcgaaaagtcgaactaa

DBGET integrated database retrieval system