KEGG   Actinobacillus suis: ASU2_01525Help
Entry
ASU2_01525        CDS       T02262                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asi  Actinobacillus suis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:asi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336913..337677
Genome map
AA seq 254 aa AA seqDB search
MNVLITRPDHRGQELVEMLNQHQIFAIHQPLFTIEAGTELPQLPSVMARLNTGDYVFAVS
KQAIDFASETLEQTGFHYRSDLNYFAVGQQSAQYFSSRSEQPVRYPIISENSEGLLLLDE
MQDLNGKNLLILRAETGRDLLAETAVSRGADVQYLECYRRKYVEENVAEKISLCKRVGVD
TIVVTSGDILTTLYEQTAEEDRVWLSECRLIVVSQRIAKMAYKLGWEQNNVILSEKADNN
SLLETVLNVIEKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttaattactcgccccgatcatcgagggcaggaattagttgagatgctgaat
cagcatcaaatttttgcgattcatcagccgctatttacaattgaagcagggacagaactt
cctcagttgccttcagttatggctcggttaaatactggtgattatgtatttgccgtttct
aaacaagcaattgatttcgcttcggaaacgttggaacaaacaggttttcattatcgttct
gacttaaattattttgcggtaggtcagcaatcggcacagtatttttcatctcgtagcgaa
cagccagtgcgttatccgattatttcggaaaatagtgaggggttgttgttattagatgaa
atgcaagatctcaatggtaagaatttattgatactacgagcggaaactgggcgtgattta
ctggcggaaaccgcagtttctcgaggtgcggacgttcaatatttggaatgttatcgcaga
aaatatgtcgaagaaaacgttgctgaaaaaatcagcttgtgtaaacgtgtcggtgtcgat
acgatagttgtcacaagtggggatattttaacaactttatatgagcaaacagcagaagaa
gaccgcgtatggttatcagaatgccgtttaattgttgttagtcaacgcattgcaaaaatg
gcatataaattgggatgggagcagaataacgtgattctctctgaaaaagcagacaataac
agtttgctggaaaccgtattgaatgtgatcgaaaagtcgaactaa

DBGET integrated database retrieval system