KEGG   Actinobacillus suis: ASU2_02395Help
Entry
ASU2_02395        CDS       T02262                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
asi  Actinobacillus suis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:asi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531514..533016
Genome map
AA seq 500 aa AA seqDB search
MTKEYIIALDQGTTSSRAVLLDKNANIVEVAQREFTQIYPQPGWVEHNPMEIWATQSSTL
NEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADTCAKLKADGH
EAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRTHV
TDYTNASRTMLFNIHTKQWDDKMLELLDIPRSMLPEVKNSSEIYGETNIGGKGGVRIPVA
GIAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGDEAVESKNGLVTTIACNAKGEPCY
ALEGSIFMGGASIQWLRDELKIIHDSKDSEYFATKVESTNGVYVVPAFTGLGAPYWDPYA
RGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDSGKHLATLRVDGGAVANNFLMQ
FQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQELRGKASIERTFIPDSDEAKRT
RRYAGWKKAVKRALEWEEEV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaatacattattgcattggatcaaggtactacaagctctcgtgccgtgtta
ttagataaaaatgcgaacattgttgaagtggcacaacgtgaatttactcagatttatcct
cagccgggttgggtagagcataatccgatggagatctgggcaacgcaaagttcaacacta
aatgaagtggtagcaaaagcagggattacgtccgataaaattgcagcaattggtattact
aaccaacgtgaaaccactattgtatgggaaaaggagaccggtaaaccggtctataatgcg
attgtttggcaatgtcgccgtaccgcagatacttgtgcaaaattaaaagcggatggacat
gaggcttatattcgtaaaacaactggtttagtggttgacccatatttttcaggcacaaaa
gtaaaatggatcttggataatgttgaaggtgcgagagagaaagctgaacgaggcgaattg
ttattcggtacagtagacacttggttagtttggaaattaactcaaggccgtacgcatgtg
accgattataccaatgcttctcgtaccatgttatttaatattcacactaaacaatgggac
gataaaatgttggaattacttgatattcctcgttctatgttacctgaagtgaaaaattca
tcagaaatttacggtgaaaccaatatcggtggtaaaggtggtgtgcgtattccggttgcc
ggcatagcgggcgaccaacaagctgcactttatggtcatctatgtgtggaagcaggacaa
gcgaaaaacacttatggtaccggctgttttatgttgatgaataccggagatgaagcagtt
gagtctaaaaatggcttagtgactaccattgcgtgtaatgcaaaaggtgaaccatgctat
gcgctggaaggttctatttttatgggtggtgcatcaattcaatggttacgtgatgagtta
aaaattattcatgacagtaaagactcggaatatttcgctactaaagtggaaagtacgaat
ggggtttatgtcgtaccggcatttaccggattaggtgcgccatattgggacccgtatgct
cgaggtgcgatattagggctttctcgtggtgcgaatcgtaaccatatcgtgcgtgctaca
ttagaatcgattgcatatcaaactcgagacgtactcgatgcgatgcagtccgatagtggt
aaacatttggctacattaagagtagatggtggcgcagttgccaataatttcttaatgcaa
ttccaagcagatattctgaatgcgaatgttgaacgtccggttgttcgtgaggtgactgca
cttggtgcggcatatctagcagggcttgcggtaggcttttggaaagatttacaggaatta
cgaggtaaagcttcaattgaacgtacttttattcctgattccgatgaagctaaacgtact
cgacgttatgcaggatggaaaaaagctgtgaagcgtgcgcttgaatgggaagaagaagtg
taa

DBGET integrated database retrieval system