KEGG   Actinobacillus suis H91-0380: ASU2_02685Help
Entry
ASU2_02685        CDS       T02262                                 

Definition
putative Lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
asi  Actinobacillus suis H91-0380
Brite
Enzymes [BR:asi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ASU2_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582201..582773
Genome map
AA seq 190 aa AA seqDB search
MSKSIKLGVITCSVAAIIGVVQTYFSDDIRINQKGLEIIGNMEGCRRDAYKCPADVITVG
IGSTEFGGKKIDVNHKYTNHEIAERWVHDLKIAQNCINTYFNGRRMNDNQFSAMSSLAFN
IGCTNIRSYYSKAQGKRVFTTIYKYAALNQFDAMCQRIIDFNKAGGVVLRGLVTRREAER
DLCLTKPVSH
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagtataaaacttggtgttataacttgttctgttgccgctatcattggtgtt
gtacaaacttatttttcggacgatatccgaatcaaccaaaagggattagagattatcggt
aacatggagggatgtcgtcgagacgcttataaatgcccagctgatgtgattactgttggc
attggctcgaccgaatttggtggaaaaaaaattgatgtgaatcataaatatacaaaccac
gaaatcgccgagcgctgggtacacgacttaaaaatcgctcagaactgtatcaatacttat
ttcaatggccgccgaatgaatgataaccaattttcggcaatgtcatcattagcgtttaat
atcggctgcaccaatattcgtagttattatagtaaagcgcaaggtaaacgcgtgtttaca
accatttataaatatgccgcattaaatcagtttgacgcaatgtgtcagcgcattatcgac
tttaataaagctggcggagtagtgttgcgtggcttggtgacgcgacgtgaggcggagcgt
gatttatgtttaacaaaaccggtatcgcattaa

DBGET integrated database retrieval system