KEGG   Actinobacillus suis: ASU2_02975Help
Entry
ASU2_02975        CDS       T02262                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asi  Actinobacillus suis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:asi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:asi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:asi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(634778..636007)
Genome map
AA seq 409 aa AA seqDB search
MTIEILTPDLPESVADATVATWHKNVGDAIKRDEVIVEIETDKVVLEVPAPHDGILAEIC
QVQGATVISKQLLGKISTVQAGDFTQETIKPTNEATPADRKSAAIEHDHSDADSQGPAIR
RLLAEHNIEAHLVKGTGVGGRITREDIEHHLAQRQTQASKQAIDTEQSTVSTVSYSARSE
KRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMADIE
KTIKELAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPV
AINGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattttaacgccggacttacccgaatctgttgcagatgcgactgttgct
acttggcataagaatgtgggtgatgcaattaaacgtgatgaagtaatcgttgaaattgaa
acggataaagtcgtattagaagtaccagcgccgcatgacggtattttagcggaaatctgc
caagttcaaggcgctactgttatttccaaacaattactcggcaaaatctcaaccgtccaa
gcaggcgatttcacccaagaaacgattaaaccaacgaatgaagcgactccggcggatcgt
aagtctgcagctattgagcatgaccattccgatgcggattctcaaggcccagcgattcgc
cgtttattggctgaacacaatattgaggctcatttagtcaaaggtaccggtgttggcggc
agaattacccgtgaagatattgaacatcatttagcacaacgtcaaacacaagcttcaaaa
caggctattgacacagagcaaagcactgtcagtaccgtgtcttactcagcacgtagcgaa
aaacgtgtgccaatgacacgtttacgtaaacgtattgctgaacgtctgttagaagcgaaa
aatacaacggcaatgttaaccacattcaatgaagtggatatgcagccgattatgacatta
cgtaaaacttacggtgaaaaatttgaaaaacaacacggtgtacgtttaggctttatgtcg
ttctatattaaagcggttgttgaagcattaaaacgttatccggaaatcaatgcatcgatt
gacggtgatgatgtggtatatcacaactatttcgatattagtattgcggtctcaacccct
cgcggcttagtcacaccggttatccgtaactgcgataaattatcgatggcggatattgag
aaaacgattaaagagcttgctgaaaaaggtcgtgacggtaaattaaccgtagaagattta
accggcggtaattttaccattacaaacggtggtgtattcggttcattaatgtctaccccg
atcatcaatccaccacaaagtgcgattttagggatgcacgccattaaagatcgcccggtt
gccataaacggccaagtggttattcgtccaatgatgtatctagcactttcttatgaccat
cgtttaattgatggacgtgaatctgttggtttcttagttgctgtcaaagatttattagaa
gatccgacacgtttattacttgaaatttaa

DBGET integrated database retrieval system