KEGG   Actinobacillus suis H91-0380: ASU2_02995Help
Entry
ASU2_02995        CDS       T02262                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
asi  Actinobacillus suis H91-0380
Brite
Enzymes [BR:asi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ASU2_02995
Secretion system [BR:asi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ASU2_02995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641704..642336
Genome map
AA seq 210 aa AA seqDB search
MADDASLKRTLERMGATNVKISDSALPGFRTAVSNEGVVQISENGRFVIQGQIFELKNGK
AVDITNKSLLADLNSLEKEMIIYPAKNEKHIVTVFMDITCHYCHLMFQRIKEYNDLGITL
RFLAFPRGGMNTQTAKQMEAIWTSTDKVKALNDAENGTLPKEVKIPNIVKKHYELGIKFG
VTGTPNMVDSSGQLIAGYVEPKELLKMLSE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgatgcaagcctcaaacgcacgttagaaagaatgggggcaacgaatgttaaa
atcagtgattcggcattaccaggttttagaactgcagtttcaaatgagggagtagttcaa
attagtgagaatggacgttttgtgattcaaggtcagatttttgaactgaaaaacggcaaa
gcggttgatattactaataaatccttacttgctgatttaaattctctagaaaaagagatg
attatttatccggcgaagaatgaaaaacatatagtgactgtgtttatggatattacgtgt
cactactgtcatttgatgttccaacgtattaaagaatataacgatttaggtattacgctt
cgttttcttgctttccctcgtggtggtatgaatactcaaacagcgaaacaaatggaagcg
atttggacatcaaccgataaagtaaaagcgttaaatgatgcggaaaacggtactttacca
aaagaagtcaaaataccaaatattgtgaaaaaacactatgagcttgggattaaatttggc
gtaacagggacaccaaatatggttgatagtagcggacaattaattgcagggtacgttgag
ccgaaagaattactcaaaatgctaagcgaatag

DBGET integrated database retrieval system