KEGG   Actinobacillus suis H91-0380: ASU2_03055Help
Entry
ASU2_03055        CDS       T02262                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00260  Glycine, serine and threonine metabolism
asi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01130  Biosynthesis of antibiotics
asi01230  Biosynthesis of amino acids
Module
asi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASU2_03055 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASU2_03055 (trpA)
Enzymes [BR:asi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ASU2_03055 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth ThiG NMO NanE
Motif
Other DBs
NCBI-ProteinID: AFU18751
UniProt: K0G3C1
Position
653813..654568
Genome map
AA seq 251 aa AA seqDB search
MPFVTLCDPDFDRSFEIIETLIANGADALELGFPFSDPLLDGPVIQAANKRALDGGYSTD
ACFEMIAKIRSKYPEIPIGLLLCANLVFVPTQEVFFKRCAETGVDAVLIADVPVLAAEEF
TQTAKKHGIQSVFICPPNADQATIERIARLTEGYTYLVSRAGVTSAENQAHAKNLDNLIE
SLKRSNSAPILQGFGIAKPEQVKEALALGCDGAISGSAIVKIIESHLDNQTRLLAELANF
VTAMKNATYRT
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtttgttaccctctgtgatccggattttgatcgttcatttgagattatcgaaaca
ctgattgctaacggtgcagacgcgttagaactcggtttccctttttctgatccactgtta
gatgggccggtgattcaagctgcgaataaacgtgcattagacggtggttacagcaccgat
gcctgttttgaaatgattgcaaaaattcgctcaaaatatcctgaaattccgattggcttg
ctgctttgtgctaacttagtcttcgtaccaacccaagaagtgtttttcaagcgctgtgcc
gaaaccggcgttgatgcagtgttaattgctgatgtgccggtacttgctgccgaagaattt
acgcaaactgctaaaaaacatggtattcaatcagtcttcatttgtccgccgaatgcggat
caggcaacgattgaacgtattgcacgtttaactgagggctatacctatttggtttctcgt
gccggtgtaaccagtgccgagaaccaagctcacgctaaaaatttagataaccttattgaa
agcctcaagcggtcaaattccgccccgattttgcaaggctttggaattgctaaacctgaa
caagtcaaagaagcattagcgcttggctgtgatggtgcgatttccggatcggcgattgtg
aaaattattgaaagtcatttagataatcaaacgcgtttactggcagaattggcaaatttt
gtgacagcaatgaaaaatgcgacttatcgcacataa

DBGET integrated database retrieval system