KEGG   Actinobacillus suis H91-0380: ASU2_03090Help
Entry
ASU2_03090        CDS       T02262                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASU2_03090 (ipk)
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ASU2_03090 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660732..661577
Genome map
AA seq 281 aa AA seqDB search
MNKVTLPSPAKLNLFLYITNRRTDGYHELQTLFQFLDFGDEISLEVNQSGEIELLNEIEG
VEKEQNLIYRAAKLLQNHTACTKGAKIGVTKRLPMGGGVGGGSSNAATVLVGLNHFWQTG
LSLEELAELGLSLGADVPIFVRGVAAFAEGVGEVLTPCEPEEKWFVVLKPSVSISTAVVF
NDPNLPRNTPKRSLAELLENKWANDCEKVVRDHYSEVEDLVQELVEYASFRLTGTGACIF
AEFDSKEDAQKVFDRKPQNVCGFVAKGQNISPLHKKLNLIP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtcactttacctagcccggctaagttaaatctttttttatacattactaac
agacgcacagacggttatcacgagttacaaaccttatttcaatttttagattttggcgat
gaaatttcactggaagtaaatcagagcggtgaaattgaattgttaaacgaaattgaagga
gtcgaaaaagagcagaacttaatttatcgagctgcaaaattattacaaaatcataccgct
tgtacgaaaggtgccaaaatcggcgtaaccaaacgtttaccaatgggtggtggcgttggc
ggaggttcatcgaatgcggcaaccgtactggttggattaaatcatttttggcaaacaggc
ttaagtcttgaagagcttgcagaactaggactgagcttaggtgcggatgtaccgattttt
gtgcgaggcgttgcggcttttgcagaaggtgtcggcgaagtgttaacaccttgtgagccg
gaagaaaaatggtttgtggtgttaaaaccgagtgtttctatttcgactgccgtcgttttt
aatgaccctaatttgcctcgaaatacgccaaaacgtagtttagcagaactgttagagaat
aaatgggcaaacgattgcgaaaaagttgtgcgagatcattattcagaggttgaagatctt
gttcaagaattggtagaatatgcatcgtttcggttaacgggcactggtgcttgtattttt
gccgaatttgattcaaaagaagacgcgcagaaagtcttcgaccgcaaacctcaaaacgtg
tgtggttttgttgctaaagggcagaacatttcgcctttgcacaaaaaattaaacttaatt
ccctaa

DBGET integrated database retrieval system