KEGG   Actinobacillus suis H91-0380: ASU2_03800Help
Entry
ASU2_03800        CDS       T02262                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ASU2_03800
   00052 Galactose metabolism
    ASU2_03800
   00500 Starch and sucrose metabolism
    ASU2_03800
   00520 Amino sugar and nucleotide sugar metabolism
    ASU2_03800
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ASU2_03800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809017..809904
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVILADFTANQKTENLAAMIKRFNETKHSQIMVAPVPKEDVSSYGVADCAGV
EIPAGETAKIVKMVEKPSVEEAPSNLAVVGRYVFSENIWDLLEKTPVGVGDEIQLTDAID
MLIEQETVEAFHMTGRTFDCGDKLGYMQAFTEYSLRHDKFGDDFKDFIKKLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgattattcctgtagcgggtcttggtactcgtatgcttccggcgactaaagca
attccaaaggaaatgttaacaattgcagataagccgttaattcaatatattgttaatgag
tgtgtggccgcaggcattaaagaaattgtgttagtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacgtcttttgagcttgaaacaatgcttgaaaaacgtgtaaaacgt
caattattagatgaagtacgttcaattgtaccgaaagacgtaacattaatgcatgtacgc
caagggcaagcaaaaggtttaggccacgcagtgttatgtggtagagcggttgtgggtaat
gaaccgtttgctgttgttcttcctgatgtgattttagcggatttcacagcaaatcagaaa
actgaaaaccttgcagcaatgatcaaacgctttaatgaaactaaacatagccaaattatg
gttgctccggtaccaaaagaagatgtaagtagctatggtgtagccgattgcgcaggtgtg
gaaattccggcgggtgagacagcgaaaatcgtgaaaatggtggaaaaaccaagtgttgaa
gaagcaccgtctaacttagcggttgttggtcgttacgtattctctgaaaacatttgggat
ctgcttgaaaaaacaccagtgggcgtaggtgatgaaattcaattaactgatgcgattgat
atgctaattgagcaagaaaccgtggaagcattccatatgactgggcgtacttttgactgt
ggtgataaattaggctatatgcaagcatttactgaatatagtttacgtcatgataagttt
ggcgatgattttaaagacttcatcaaaaaattagctaaaacattataa

DBGET integrated database retrieval system