KEGG   Actinobacillus suis H91-0380: ASU2_03800Help
Entry
ASU2_03800        CDS       T02262                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00040  Pentose and glucuronate interconversions
asi00052  Galactose metabolism
asi00500  Starch and sucrose metabolism
asi00520  Amino sugar and nucleotide sugar metabolism
asi01100  Metabolic pathways
asi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ASU2_03800
   00052 Galactose metabolism
    ASU2_03800
   00500 Starch and sucrose metabolism
    ASU2_03800
   00520 Amino sugar and nucleotide sugar metabolism
    ASU2_03800
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ASU2_03800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFU18898
UniProt: K0G420
Position
809017..809904
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVILADFTANQKTENLAAMIKRFNETKHSQIMVAPVPKEDVSSYGVADCAGV
EIPAGETAKIVKMVEKPSVEEAPSNLAVVGRYVFSENIWDLLEKTPVGVGDEIQLTDAID
MLIEQETVEAFHMTGRTFDCGDKLGYMQAFTEYSLRHDKFGDDFKDFIKKLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgattattcctgtagcgggtcttggtactcgtatgcttccggcgactaaagca
attccaaaggaaatgttaacaattgcagataagccgttaattcaatatattgttaatgag
tgtgtggccgcaggcattaaagaaattgtgttagtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacgtcttttgagcttgaaacaatgcttgaaaaacgtgtaaaacgt
caattattagatgaagtacgttcaattgtaccgaaagacgtaacattaatgcatgtacgc
caagggcaagcaaaaggtttaggccacgcagtgttatgtggtagagcggttgtgggtaat
gaaccgtttgctgttgttcttcctgatgtgattttagcggatttcacagcaaatcagaaa
actgaaaaccttgcagcaatgatcaaacgctttaatgaaactaaacatagccaaattatg
gttgctccggtaccaaaagaagatgtaagtagctatggtgtagccgattgcgcaggtgtg
gaaattccggcgggtgagacagcgaaaatcgtgaaaatggtggaaaaaccaagtgttgaa
gaagcaccgtctaacttagcggttgttggtcgttacgtattctctgaaaacatttgggat
ctgcttgaaaaaacaccagtgggcgtaggtgatgaaattcaattaactgatgcgattgat
atgctaattgagcaagaaaccgtggaagcattccatatgactgggcgtacttttgactgt
ggtgataaattaggctatatgcaagcatttactgaatatagtttacgtcatgataagttt
ggcgatgattttaaagacttcatcaaaaaattagctaaaacattataa

DBGET integrated database retrieval system