KEGG   Actinobacillus suis: ASU2_05125Help
Entry
ASU2_05125        CDS       T02262                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
asi  Actinobacillus suis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:asi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1137730..1138920)
Genome map
AA seq 396 aa AA seqDB search
MKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMAAQCLLFQPKFAALDDEN
AAKALAEQLKQFNVKTEVLSGQKAICELSAHPEVDMVMAAIVGAAGLLPTLSAVKAGKKV
LLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLPPEAQQKVGFCPLAELGVSK
IILTGSGGPFRVKPLDEFASITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFN
ASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTPIAHTMAYPKRINAGVAPLDFF
KLKELTFIEPDFARYPNLKLAIDAFAEGQYATTAMNAANEVAVEAFLNERIRFIDIVNVN
RTVVENIAPIQVTEIADVLHIDKLARELAEQAVINL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattagtgattttaggttcaaccggctcaatcggtaaaagcactttatctgtg
gtggaacagaacaaaacggaatacgaggtattcggtttagttggtggtaaaaatgttgaa
ttaatggcagcgcaatgtttattgtttcaaccgaaatttgccgctctagatgatgagaat
gcagcaaaagcgttagcggaacagctcaaacaattcaatgtaaaaaccgaagtgctaagc
ggccaaaaagcgatttgtgaactaagcgctcaccccgaagtggatatggtgatggcggca
attgttggggcggcaggtttgttaccaaccctttcagcggttaaggccggtaaaaaagtt
ttattggccaataaagaatcgttagttacttgcggacaaatttttattgatgaagcgaga
aaatctggcgcgcagttattaccggttgatagtgaacacaatgcgattttccaatctcta
ccaccggaagcgcaacaaaaagtcggtttttgcccgcttgcagagttaggcgtgagtaaa
attattttaaccggttcaggcggtccgtttcgtgtaaaaccactcgatgagtttgcaagt
attactccggcacaagcggtggcacatccgaattggtcaatgggtaagaaaatctcagtc
gacagtgccactatgatgaataaaggtttggaatatattgaggctcgttggctattcaat
gcttcggcagaggagatggaaattattattcatccgcaatctattattcactcgatggta
cgttatattgacggctcggttatcgctcaaatggggaatccggatatgtgtacaccgatt
gcgcatactatggcatatccgaagcggattaatgcaggtgtggcaccgttagatttcttt
aaattgaaagaattaacttttatcgaaccggactttgcccgctatccaaatttgaaatta
gcgattgatgcatttgcagaagggcaatatgcgacaaccgcaatgaatgcggcaaatgaa
gtggcggtagaagctttcttaaatgaacgtattcgttttattgatattgtgaatgtgaat
agaacggtagtggaaaatattgcaccgattcaagtaacagaaatagctgatgtgttacat
attgataagctggcacgggaattagcagaacaagctgtgattaatctataa

DBGET integrated database retrieval system