KEGG   Actinobacillus suis H91-0380: ASU2_05230Help
Entry
ASU2_05230        CDS       T02262                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASU2_05230
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ASU2_05230
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ASU2_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1161843..1162859
Genome map
AA seq 338 aa AA seqDB search
MLELVKQIAQLHQHHRVIVVTSGAAAAGRDYLGHPELPKTLAYKQMLAAVGQSQLIRTWE
NLFDIYGIHIGQILLTRADIDDRERFLNARDTLNALLEQKIIPVINENDTVATEEFKVGD
NDNLSALVAILAHADQLYLLTDQEGLFSADPRKDPNASLLSVVERITPEIRQIAGGSSTG
LGTGGMSTKITAADIATRSGVETIIASGSRENVLVDLANDVAIGSKFLVQSDRLEGRKQW
LFAAPQVGALTVDKGAETALLQHKSLLPVGVSDIKGVFSRGEVVKIFNQEGKALALGLAR
YSSEALERIKGKKSAEIESLLGYEFGSVAVHIDEMVIY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgttagagttagttaaacaaatcgctcaactgcatcagcatcatcgtgtgattgttgtg
acatctggtgctgcggcggctgggcgtgattatctcggtcatcctgaacttcccaaaacg
cttgcttataaacaaatgttagcggcggttggacaaagccaactgattcgtacttgggaa
aatttattcgatatttatggcattcatatcgggcaaattttattaacccgtgccgatatt
gacgatcgtgaacgtttcctaaatgctcgagatacgctaaatgcgctgttagaacaaaaa
atcattccggttatcaatgaaaatgacacggtggcaaccgaagaatttaaagtgggcgat
aacgataacttatctgctttagttgcgatccttgcacacgccgaccaactctatttatta
accgaccaagaggggctttttagcgcagaccctcgtaaagatccgaatgcgtcgcttctt
tctgtcgttgaaaggatcacgccggaaattcgtcaaattgccggcggaagttcaaccgga
ctcggtaccggtggcatgagcacaaaaattactgcggcagatattgctactcgttcaggt
gtagagacgattattgcttcaggctctcgtgaaaacgtgttggttgatttagccaatgat
gtggcgatcggtagcaaatttttagtgcaatccgaccgcttagaaggcagaaaacagtgg
ttattcgctgccccgcaggtgggggcattaacagttgataaaggtgcggaaaccgcatta
ttacaacataaatcactcttgcctgtcggtgtttcagatataaaaggggtctttagtcgt
ggcgaagtggttaaaatctttaatcaagaaggcaaagctcttgcgctcggcttagcacgt
tacagtagcgaagcgttagaacgcattaaaggcaagaaatcagcagaaatcgaatcattg
ttaggctatgaattcggctcagttgccgtacatatagatgaaatggtgatttattaa

DBGET integrated database retrieval system