KEGG   Actinobacillus suis H91-0380: ASU2_05250Help
Entry
ASU2_05250        CDS       T02262                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00071  Fatty acid degradation
asi00280  Valine, leucine and isoleucine degradation
asi00281  Geraniol degradation
asi00310  Lysine degradation
asi00362  Benzoate degradation
asi00380  Tryptophan metabolism
asi00410  beta-Alanine metabolism
asi00640  Propanoate metabolism
asi00650  Butanoate metabolism
asi00903  Limonene and pinene degradation
asi00930  Caprolactam degradation
asi01040  Biosynthesis of unsaturated fatty acids
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01130  Biosynthesis of antibiotics
asi01200  Carbon metabolism
asi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ASU2_05250
   00650 Butanoate metabolism
    ASU2_05250
  Lipid metabolism
   00071 Fatty acid degradation
    ASU2_05250
   01040 Biosynthesis of unsaturated fatty acids
    ASU2_05250
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASU2_05250
   00310 Lysine degradation
    ASU2_05250
   00380 Tryptophan metabolism
    ASU2_05250
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASU2_05250
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ASU2_05250
   00281 Geraniol degradation
    ASU2_05250
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASU2_05250
   00930 Caprolactam degradation
    ASU2_05250
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ASU2_05250
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ASU2_05250
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ASU2_05250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 FeThRed_B
Motif
Other DBs
NCBI-ProteinID: AFU19188
UniProt: K0G4Z6
Position
1165803..1167923
Genome map
AA seq 706 aa AA seqDB search
MIEQQEPTPVFQVEIDDNRIAIIRIQTLDNDANWLPENFVSELRRVIGSVIYQQARGVIF
ISARAHNFIQGFKPSILKEKTAEQLRLFSQEAQAVMREINTLKMPVIAAIDGNCFGLGLE
LALACDYRLATDEHHTQFAMPQVRSGLLPFASGTQRLPRLIGLQNATPLLLFGHKINAEQ
AKKFMLVDKLVPATRLFDTAYQMLLNNKVQKVDYKRPLTLFKKWRKQLEGNTLFRNKFLD
RTENLVWLKTFGNYPAVARLIELLKEPHFKAGLTLEQHAFAELFHTETSKVLIDLKKTER
AMKDKYRIRGDVRDVLQVSVLGSGYMGAGIAYLTANNAQVPVRIKDIHPSEIRKALRTCY
ELMRNEVDKNQLKPGQMIQRMNLITGGERLVAAKSTDFVIEAVYEDLKLKQRMLQESEAY
YDEHAIFATNTSTFAIRDIAAVAKRPENVIGFHYFSPVAKQKMVEIVPHEGTCEHTIATA
IHFAIQQGKVPLLVADKQGFFINRILTPFLLEAIQCLVDGESIEFIDRSLQEFGFHLGPL
AVIDEMGLDVIAKSNPALVRELGRRFSLPESVDLLIRNERKGCKNKRGFYMYDSKGERLQ
EDKSIYHVMETIARNDLESEQIARRCILRMLNEAAWCLQDNVIQSIDEGNVASVLGAGFP
EFRGGIYAYMEKISAQEIVKQLRQHAKQYGSRFEPCEWLIQQAEQA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacaacaagaaccaacaccggtgtttcaagtagaaattgatgataaccgtatt
gcgattattcgtattcaaactttagataatgatgctaactggttaccggaaaactttgtc
agcgaactacgccgcgtcatcggtagtgtcatctatcagcaagctagaggtgtgattttt
atctctgctcgtgcccacaattttattcaaggcttcaagccgagcattctaaaagagaaa
acagcagaacaattacgcctgttttcacaagaagcgcaagcagtaatgcgtgaaattaat
acgctaaaaatgccggtgatcgccgcaattgacggcaattgtttcggcttaggcttagaa
ttagcattggcgtgtgattatcgtttagcaacggatgaacatcacacacaatttgcgatg
ccgcaagtacgttccggcttattaccgtttgccagcggtacgcaacgtttacctcgttta
atcggcttacaaaatgccacaccactgttgctctttgggcataaaatcaatgccgaacaa
gcaaaaaaatttatgttagtcgataagctcgtgccggcaaccagactttttgataccgct
tatcaaatgttattaaataacaaagtgcaaaaagttgactataaacgaccgcttacctta
ttcaaaaaatggcgtaaacaactggaaggcaacacgctatttcgtaataagtttctcgat
cgtaccgaaaatttagtatggctaaaaaccttcggtaactaccctgcggttgctcgtctg
atcgaattactgaaagagccacatttcaaggctgggttaaccctagaacaacatgcattc
gctgagttatttcataccgaaacctcaaaagttttgattgatttgaaaaaaaccgaacgt
gcgatgaaagataaatatcgcattcgtggtgatgtacgagatgtattgcaagtaagtgtg
cttggttctggctatatgggcgctggcatcgcttatttaactgcaaataatgcgcaagta
ccggtacgaattaaagacattcatccttcggagatccgtaaagcactacgtacctgctac
gaattgatgcgcaatgaagtggataaaaaccagctcaagccggggcaaatgattcagaga
atgaacctaattaccggcggtgagcgtcttgttgcagcaaaatcgaccgattttgttatc
gaagccgtgtatgaagatctcaagctaaaacaacgtatgttgcaagaaagcgaagcctat
tatgacgaacacgcgatttttgcgaccaacacgtcaacttttgcaatccgagatatcgct
gcagtcgctaagcgtccggaaaatgtaattggcttccactactttagcccagtggcgaag
caaaaaatggttgaaatcgtaccgcatgaaggcacttgtgaacatacgattgccacggcg
attcactttgcaattcagcaaggaaaagtgccgttattagtcgctgataaacaaggcttc
tttattaaccgcattttaacgccgttcttattagaagcaattcaatgcttagtcgatggc
gaatccattgagtttatcgaccgttccttgcaagaattcggtttccatttaggtccgtta
gcggttattgatgaaatgggtttagatgtgattgccaaatcaaaccctgctttggttcgt
gaattaggcagacgttttagtttgccggaaagtgtcgatttactgattcgcaatgaacgc
aaaggctgtaagaataaacgcggcttttatatgtatgattctaaaggcgaacgtttgcaa
gaggacaaaagtatttatcatgtgatggaaaccatcgctcgtaatgatttggaatccgaa
caaattgcccgccgttgtattctgcgtatgctgaatgaagcggcgtggtgtttacaagat
aatgttattcagtctattgatgaaggtaatgtggcttccgtacttggtgccggtttccct
gaatttagaggcgggatttacgcctatatggaaaaaatcagcgctcaagaaatcgttaag
caattgcgtcaacatgctaaacaatacggtagtcgctttgaaccttgcgaatggctaata
caacaggctgaacaagcttaa

DBGET integrated database retrieval system