KEGG   Actinobacillus suis H91-0380: ASU2_05640Help
Entry
ASU2_05640        CDS       T02262                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ASU2_05640
  Lipid metabolism
   00561 Glycerolipid metabolism
    ASU2_05640
   00600 Sphingolipid metabolism
    ASU2_05640
Enzymes [BR:asi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ASU2_05640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245621..1247759
Genome map
AA seq 712 aa AA seqDB search
MNNIIRLSSNQNDLIINASDNPQILYWGEKLAQFEPTNAWLSYSGVTNGGLDIDVPVSLA
AENGRGYFESSSVEGHRNGLDSMPVFKLSKIEQKNDRLIIRQTDEIAGLEFSSEFVLDKA
TSVLKTRNKLRNLKAENYYVDRLAVTLPLPEFADEVCTFYGRWVREFQPNRQNLKHGGFI
QENRVGRTSHEYPPILIVGEEGYKEQKGDVWGFHLAWSGNHRIRADIDIRGRRSVQLEAL
YFPGEITLAQNEEIATPWVYATASNQGLNGMSQQFHQYVRENILRFPQGKTRPVHLNIWE
GVYFDHKPEHIIAMAKAAAEMGVERFIIDDGWFIGRDDDFGGLGDWYLDERKYPNGLTPV
VKAVKDLGMQFGIWVELEMINKPTKLYQQHPDWLLAVEGYDQPAERNQFVLDLCNPEVFD
YLVERMDWLLGNHDIDYVKWDMNRRIVQGAHQGKAAVTKQTEAFYRLCDVLCEKYPNVEF
EACSSGGGRIDYEVLKRSQRFWTSDDNDALERQTIQRGFSYFYPPEIMGAHIGGFHCHTT
YRKLDANFRGLTALFGHMGVELDPVKEGEEERKNFAKYIALHKSLRELLHSGTAFRLDRK
DPASLVNGVVAKDGSQAVVLINQLAMLDYLRQESLRVPYLDKGNYQVEILDLPRNFAEGK
FGHLMKQLPEWMVKVLNGERVVINSEWLAKVGLGLPIIDPASAMLLKFTRIA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatcattcgcttatctagcaaccaaaacgatctgattattaacgcctcagat
aatcctcaaattctctattggggcgaaaaattagcacaatttgaaccgactaatgcttgg
ctcagctactcaggtgtaacaaacggcggtttagatattgatgtgccggtttcacttgca
gcggaaaacggacgtggctattttgaatcgtcttcggttgaaggccatcgtaacggttta
gactcaatgccggtgttcaaattaagtaaaattgaacaaaaaaatgaccgcttgatcatc
cgtcaaacggatgaaattgccggcttggaatttagcagtgagtttgtattagataaagcg
acttccgtattaaaaacacgtaataagttacgtaatttaaaagcagaaaactattacgtt
gatcgccttgctgttactcttccacttcccgaattcgctgatgaagtttgtacgttctac
ggtcgctgggtgcgtgaattccaaccgaatcgccaaaacctcaaacacggcggttttatt
caagaaaaccgtgtcggcagaacatctcacgaatatccgccgattttgattgtcggtgaa
gaaggctataaagaacaaaaaggtgatgtatggggcttccatttggcttggagcggaaac
caccgtattcgtgcagatattgatattcgaggcagacgtagcgtgcaattggaagcgcta
tactttccaggtgaaatcacactagcacaaaatgaagagattgcgactccttgggtttat
gcaaccgcttctaaccaaggcttaaacggtatgagccagcaatttcatcaatatgtacgc
gaaaatattctccgttttccgcaaggtaaaacacgtccggtacacctcaatatttgggaa
ggcgtttacttcgatcacaaaccggaacatattatcgccatggcgaaagctgccgcagaa
atgggcgtagaacgttttattattgatgacggttggtttattggacgtgatgatgatttc
ggcggtttgggcgactggtatttagatgaacgcaaatatccaaacggtttaacgccggtg
gtcaaagcggtaaaagatctcggtatgcaattcgggatttgggttgagttagaaatgatc
aacaaaccgaccaaactttaccaacaacacccagattggttactcgcagttgaaggttac
gatcaacctgccgaacgtaaccaatttgtgctcgacctttgcaatccggaagttttcgat
tatttagtggaacgaatggattggttactcggcaatcacgatattgactatgtaaaatgg
gatatgaaccgccgtatcgtgcaaggtgctcaccaaggaaaagccgcagtcaccaaacaa
accgaagccttctatcgcttgtgtgatgtgctttgtgaaaaatatccgaatgttgaattt
gaagcctgctcttccggcggcggtcgtattgattacgaggtattaaaacgttcacaacgc
ttctggacttccgatgataatgatgcacttgaacgtcaaaccattcaacgcggctttagt
tacttctatccacctgaaattatgggggcgcatatcggcggcttccattgccatactaca
taccgcaaattagatgcgaatttccgtggtttaactgcgctattcggtcatatgggtgtg
gaattagatccggtaaaagaaggtgaggaagaacgtaaaaattttgctaaatatattgcg
ttacataaatccttacgagaactattacatagtggcacggcattccgtttagaccgtaaa
gaccccgcatctcttgtgaacggtgtcgttgcaaaagatggctcccaagcggtggtttta
atcaaccaacttgcaatgctcgattacttacgtcaggaatcactacgagtgccatacctc
gataaaggcaattatcaagtagaaattctggatttaccacgtaactttgccgaaggcaaa
ttcggtcacttgatgaaacaattaccggaatggatggtaaaagtattaaacggtgaaaga
gttgtcattaacagtgaatggttggcaaaagtcggtttaggcttaccgattattgaccca
gcttccgcaatgctattgaaatttactcgtatcgcttaa

DBGET integrated database retrieval system