KEGG   Actinobacillus suis: ASU2_05800Help
Entry
ASU2_05800        CDS       T02262                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
asi  Actinobacillus suis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:asi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:asi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282766..1283902
Genome map
AA seq 378 aa AA seqDB search
MKKIISLLTLIFIGLLSSCSSSTVNAMNHSQIKEAGLTLDIARRFYPVETIKQFIDTIHH
AGGTFLHLHFSDHENYALESTYLDQSEANAIVKDGTYYNPKTNKPFLTYKQIHDIIYYAK
SKNIELVPEVDTPNHMTAIFRLLEAKHGKDYVKKLKSKMNDEEIDITNPESIEVIKTLIA
EVIYIFGHASEHFHIGGDEFGYSVETNHEFISYVNTLNQFINEKGKITRIWNDGLIKNNL
NQLNKNVEITYWSYDGDAQESQDIAERRKIRANLPELLENGFKVLNYNSYYLYFVPKGNA
NITHDSKYATEDVLNNWKLGLWDGQNKENMVENTKNIIGSSLSIWGERSGSLSSEVIEES
TQDLLKAVIQKTNDPKSH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatctcattactgactttaatttttatcggattactttcctcctgctca
tcatccactgttaatgcaatgaatcactcacaaataaaagaagcgggactaacccttgat
atagctcgccgtttctatccggttgaaaccataaaacaatttatcgatacaattcaccat
gcaggaggtacattcttacacttacatttttcggaccatgaaaattatgcgttagaaagt
acttatttagatcaatcggaagcaaatgcgatagttaaagacggtacttattataatcca
aaaaccaataaaccttttttaacctataaacaaattcacgatattatttattatgccaag
agtaaaaatattgaattggtgccggaagttgatacaccgaatcatatgacggcaatattt
cgactacttgaggctaaacacggtaaggattatgtcaaaaagctaaaatccaaaatgaat
gatgaggaaattgatataactaaccccgaatcaattgaagttattaaaacattaattgcc
gaagtgatttatatttttggacatgccagcgaacattttcatattggtggcgatgaattc
ggctatagcgtagaaaccaatcacgaatttattagctacgtaaatacgcttaatcagttt
attaacgagaaaggcaaaattacgcgtatttggaatgacggtttaattaaaaataattta
aatcaattaaataaaaatgtagagatcacttattggagctatgacggtgatgctcaagaa
agtcaagatattgcagaacgccgcaaaattcgtgcaaacttgccggaattactcgaaaac
ggttttaaagtattaaattataattcgtattatctttattttgtgccgaaaggtaatgcc
aatattacgcatgacagtaaatatgcaacagaagatgtattaaataactggaaactcggt
ttatgggatgggcaaaataaagaaaatatggttgaaaataccaagaatattatcggttct
tcgctttctatttggggagaacgttcaggatcattaagtagtgaggtgattgaggagtcc
acccaagatctattaaaagcagtgattcaaaaaaccaatgatccgaaatcgcattag

DBGET integrated database retrieval system