KEGG   Actinobacillus suis H91-0380: ASU2_05800Help
Entry
ASU2_05800        CDS       T02262                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ASU2_05800
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ASU2_05800
Enzymes [BR:asi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ASU2_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282766..1283902
Genome map
AA seq 378 aa AA seqDB search
MKKIISLLTLIFIGLLSSCSSSTVNAMNHSQIKEAGLTLDIARRFYPVETIKQFIDTIHH
AGGTFLHLHFSDHENYALESTYLDQSEANAIVKDGTYYNPKTNKPFLTYKQIHDIIYYAK
SKNIELVPEVDTPNHMTAIFRLLEAKHGKDYVKKLKSKMNDEEIDITNPESIEVIKTLIA
EVIYIFGHASEHFHIGGDEFGYSVETNHEFISYVNTLNQFINEKGKITRIWNDGLIKNNL
NQLNKNVEITYWSYDGDAQESQDIAERRKIRANLPELLENGFKVLNYNSYYLYFVPKGNA
NITHDSKYATEDVLNNWKLGLWDGQNKENMVENTKNIIGSSLSIWGERSGSLSSEVIEES
TQDLLKAVIQKTNDPKSH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatctcattactgactttaatttttatcggattactttcctcctgctca
tcatccactgttaatgcaatgaatcactcacaaataaaagaagcgggactaacccttgat
atagctcgccgtttctatccggttgaaaccataaaacaatttatcgatacaattcaccat
gcaggaggtacattcttacacttacatttttcggaccatgaaaattatgcgttagaaagt
acttatttagatcaatcggaagcaaatgcgatagttaaagacggtacttattataatcca
aaaaccaataaaccttttttaacctataaacaaattcacgatattatttattatgccaag
agtaaaaatattgaattggtgccggaagttgatacaccgaatcatatgacggcaatattt
cgactacttgaggctaaacacggtaaggattatgtcaaaaagctaaaatccaaaatgaat
gatgaggaaattgatataactaaccccgaatcaattgaagttattaaaacattaattgcc
gaagtgatttatatttttggacatgccagcgaacattttcatattggtggcgatgaattc
ggctatagcgtagaaaccaatcacgaatttattagctacgtaaatacgcttaatcagttt
attaacgagaaaggcaaaattacgcgtatttggaatgacggtttaattaaaaataattta
aatcaattaaataaaaatgtagagatcacttattggagctatgacggtgatgctcaagaa
agtcaagatattgcagaacgccgcaaaattcgtgcaaacttgccggaattactcgaaaac
ggttttaaagtattaaattataattcgtattatctttattttgtgccgaaaggtaatgcc
aatattacgcatgacagtaaatatgcaacagaagatgtattaaataactggaaactcggt
ttatgggatgggcaaaataaagaaaatatggttgaaaataccaagaatattatcggttct
tcgctttctatttggggagaacgttcaggatcattaagtagtgaggtgattgaggagtcc
acccaagatctattaaaagcagtgattcaaaaaaccaatgatccgaaatcgcattag

DBGET integrated database retrieval system