KEGG   Actinobacillus suis: ASU2_05900Help
Entry
ASU2_05900        CDS       T02262                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asi  Actinobacillus suis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ASU2_05900
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ASU2_05900
Enzymes [BR:asi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ASU2_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1308807..1309844
Genome map
AA seq 345 aa AA seqDB search
MLLIDIKDKELSQEEVEILEHPLVSGLILFSRNFHDKAQLEALVKSIRQRVKKPLLITVD
QEGGRVQRFREGFTKLPAMQAFHTLAKNPQESTALAQQTGWLMAAEMFALDIDLSFAPVL
DLGHQCKAIGDRSFGENPDMILPIAEAFIDGMREMGMATTGKHFPGHGHVLADSHLETPF
DDRLKELIFNHDILPFKQLISKGKLSAIMPAHVIYTQCDSQPASGSEYWLKQVLRSQLNF
NGVIFSDDLGMKGAGFMGNFVERSEKAIHAGCDLLLLCNEPEGVIQVLDGLKYQPSKAQT
ERHISLMKRKTVSWNELEASPRYQQAQQRLTALQNEWLEYKAQHC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttactgattgatataaaagataaagaactcagccaagaagaggttgaaatccttgaa
catcctctcgtatctggcttgattttatttagccgtaattttcacgataaagcacaactg
gaagccttagtgaaatcgattcgccaacgagtaaaaaaaccgttattgattactgttgat
caagaaggtggtcgagtgcagcgtttccgtgaaggctttactaaattaccggcaatgcaa
gcgtttcatacacttgcaaaaaatccgcaagaatcaaccgctttagcccaacaaaccggt
tggttaatggccgctgaaatgttcgccttagatattgatttaagttttgcaccagtctta
gatttaggtcatcaatgtaaagccattggcgatcgttcgtttggcgaaaatccggatatg
attctgccgatagctgaagcgtttattgacggcatgagagaaatgggaatggcgacgacc
ggtaaacatttccccggtcacggacatgtattagccgattcacatctagaaacacctttt
gatgatcgcctgaaagaattaattttcaaccatgatattttgccgtttaaacaattgatc
tcaaaaggtaaattgtcagcaattatgccggctcatgttatttatacacaatgtgatagc
caaccggcaagcggttcggaatattggttaaagcaagtattacgtagtcagcttaatttt
aacggtgtgatattttccgatgacttaggtatgaaaggtgccggttttatgggtaatttt
gtcgaaagatcggagaaagcaattcacgcaggttgtgatttactactactctgtaatgag
ccagaaggtgttattcaagtgttggacggtttaaaatatcaaccaagcaaagcccaaact
gaacgtcatatttccttgatgaaacgtaaaacagtaagctggaacgagcttgaagcaagt
cctcgttatcagcaagcacagcaacgcttaaccgcattacaaaacgaatggcttgaatat
aaagcacaacattgctaa

DBGET integrated database retrieval system